BLASTX nr result
ID: Cephaelis21_contig00018566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018566 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002448069.1| hypothetical protein SORBIDRAFT_06g020460 [S... 86 4e-15 ref|NP_001066595.1| Os12g0288900 [Oryza sativa Japonica Group] g... 85 5e-15 gb|EAY82820.1| hypothetical protein OsI_38030 [Oryza sativa Indi... 85 5e-15 ref|XP_004142774.1| PREDICTED: mitochondrial inner membrane prot... 84 9e-15 ref|XP_002526954.1| protein with unknown function [Ricinus commu... 84 1e-14 >ref|XP_002448069.1| hypothetical protein SORBIDRAFT_06g020460 [Sorghum bicolor] gi|241939252|gb|EES12397.1| hypothetical protein SORBIDRAFT_06g020460 [Sorghum bicolor] Length = 207 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/49 (79%), Positives = 41/49 (83%) Frame = +1 Query: 1 NCAHHACSEIRAGHLSGDCHYKREFLRGFMKIRGHEQESTWCVQTKTYL 147 NCAHHACSEIRA HLSGDCHYKRE LRGFMKIRGHEQE CV+ + L Sbjct: 127 NCAHHACSEIRANHLSGDCHYKRELLRGFMKIRGHEQE---CVKRRALL 172 >ref|NP_001066595.1| Os12g0288900 [Oryza sativa Japonica Group] gi|77554343|gb|ABA97139.1| kub3-prov protein, putative, expressed [Oryza sativa Japonica Group] gi|113649102|dbj|BAF29614.1| Os12g0288900 [Oryza sativa Japonica Group] gi|125579058|gb|EAZ20204.1| hypothetical protein OsJ_35802 [Oryza sativa Japonica Group] Length = 204 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = +1 Query: 1 NCAHHACSEIRAGHLSGDCHYKREFLRGFMKIRGHEQESTWCVQTKTYLQGFNS 162 NCAHHACSEIRA HLSGDCHYKRE LRGFMKIRGHEQE CV+ + + N+ Sbjct: 124 NCAHHACSEIRANHLSGDCHYKRELLRGFMKIRGHEQE---CVKRRALMSVKNN 174 >gb|EAY82820.1| hypothetical protein OsI_38030 [Oryza sativa Indica Group] Length = 204 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = +1 Query: 1 NCAHHACSEIRAGHLSGDCHYKREFLRGFMKIRGHEQESTWCVQTKTYLQGFNS 162 NCAHHACSEIRA HLSGDCHYKRE LRGFMKIRGHEQE CV+ + + N+ Sbjct: 124 NCAHHACSEIRANHLSGDCHYKRELLRGFMKIRGHEQE---CVKRRALMSVKNN 174 >ref|XP_004142774.1| PREDICTED: mitochondrial inner membrane protease ATP23-like [Cucumis sativus] gi|449483813|ref|XP_004156699.1| PREDICTED: mitochondrial inner membrane protease ATP23-like [Cucumis sativus] Length = 195 Score = 84.3 bits (207), Expect = 9e-15 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +1 Query: 1 NCAHHACSEIRAGHLSGDCHYKREFLRGFMKIRGHEQESTWCVQTK 138 NC HHACSEIRAGHLSGDCHYKRE LRGFMK+RGHEQE CV+ + Sbjct: 115 NCTHHACSEIRAGHLSGDCHYKRELLRGFMKLRGHEQE---CVRRR 157 >ref|XP_002526954.1| protein with unknown function [Ricinus communis] gi|223533706|gb|EEF35441.1| protein with unknown function [Ricinus communis] Length = 187 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +1 Query: 1 NCAHHACSEIRAGHLSGDCHYKREFLRGFMKIRGHEQESTWCVQTK 138 NC HHACSEIRAGHLSGDCHYKRE LRG+MKIRGHEQE CV+ + Sbjct: 107 NCVHHACSEIRAGHLSGDCHYKRELLRGYMKIRGHEQE---CVRRR 149