BLASTX nr result
ID: Cephaelis21_contig00017955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017955 (934 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002867873.1| hypothetical protein ARALYDRAFT_492801 [Arab... 112 1e-22 ref|XP_002513693.1| tripeptidyl peptidase II, putative [Ricinus ... 112 1e-22 ref|NP_193817.2| tripeptidyl peptidase ii [Arabidopsis thaliana]... 111 3e-22 gb|AAM20148.1| unknown protein [Arabidopsis thaliana] 111 3e-22 emb|CAB45880.1| putative protein [Arabidopsis thaliana] gi|72688... 111 3e-22 >ref|XP_002867873.1| hypothetical protein ARALYDRAFT_492801 [Arabidopsis lyrata subsp. lyrata] gi|297313709|gb|EFH44132.1| hypothetical protein ARALYDRAFT_492801 [Arabidopsis lyrata subsp. lyrata] Length = 1379 Score = 112 bits (281), Expect = 1e-22 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = -3 Query: 197 YKFKLEDSSEIKPHIPLLNNHIYDNKFESQFYMISDSNKRVDAMGDVYPNST*LPKGEYT 18 YKFKLEDS+E+KP+IPLLNN IYD KFESQFYMISD+NKRV AMGDVYP S+ LPKGEY Sbjct: 946 YKFKLEDSAEVKPYIPLLNNRIYDTKFESQFYMISDANKRVYAMGDVYPESSKLPKGEYK 1005 Query: 17 LQLFL 3 LQL+L Sbjct: 1006 LQLYL 1010 >ref|XP_002513693.1| tripeptidyl peptidase II, putative [Ricinus communis] gi|223547601|gb|EEF49096.1| tripeptidyl peptidase II, putative [Ricinus communis] Length = 1301 Score = 112 bits (281), Expect = 1e-22 Identities = 54/65 (83%), Positives = 58/65 (89%) Frame = -3 Query: 197 YKFKLEDSSEIKPHIPLLNNHIYDNKFESQFYMISDSNKRVDAMGDVYPNST*LPKGEYT 18 YK KLED+SEIKP IPLLNN IYDNKFESQFYMISD+NKRV AMGDVYP S+ LPKGEY Sbjct: 867 YKLKLEDASEIKPQIPLLNNRIYDNKFESQFYMISDNNKRVYAMGDVYPKSSKLPKGEYN 926 Query: 17 LQLFL 3 LQL+L Sbjct: 927 LQLYL 931 >ref|NP_193817.2| tripeptidyl peptidase ii [Arabidopsis thaliana] gi|332658968|gb|AEE84368.1| tripeptidyl peptidase ii [Arabidopsis thaliana] Length = 1380 Score = 111 bits (277), Expect = 3e-22 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = -3 Query: 197 YKFKLEDSSEIKPHIPLLNNHIYDNKFESQFYMISDSNKRVDAMGDVYPNST*LPKGEYT 18 YKFKLEDS+E+KP+IPLLNN IYD KFESQF+MISD+NKRV AMGDVYP S+ LPKGEY Sbjct: 947 YKFKLEDSAEVKPYIPLLNNRIYDTKFESQFFMISDTNKRVYAMGDVYPESSKLPKGEYK 1006 Query: 17 LQLFL 3 LQL+L Sbjct: 1007 LQLYL 1011 >gb|AAM20148.1| unknown protein [Arabidopsis thaliana] Length = 1346 Score = 111 bits (277), Expect = 3e-22 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = -3 Query: 197 YKFKLEDSSEIKPHIPLLNNHIYDNKFESQFYMISDSNKRVDAMGDVYPNST*LPKGEYT 18 YKFKLEDS+E+KP+IPLLNN IYD KFESQF+MISD+NKRV AMGDVYP S+ LPKGEY Sbjct: 913 YKFKLEDSAEVKPYIPLLNNRIYDTKFESQFFMISDTNKRVYAMGDVYPESSKLPKGEYK 972 Query: 17 LQLFL 3 LQL+L Sbjct: 973 LQLYL 977 >emb|CAB45880.1| putative protein [Arabidopsis thaliana] gi|7268881|emb|CAB79085.1| putative protein [Arabidopsis thaliana] Length = 1396 Score = 111 bits (277), Expect = 3e-22 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = -3 Query: 197 YKFKLEDSSEIKPHIPLLNNHIYDNKFESQFYMISDSNKRVDAMGDVYPNST*LPKGEYT 18 YKFKLEDS+E+KP+IPLLNN IYD KFESQF+MISD+NKRV AMGDVYP S+ LPKGEY Sbjct: 968 YKFKLEDSAEVKPYIPLLNNRIYDTKFESQFFMISDTNKRVYAMGDVYPESSKLPKGEYK 1027 Query: 17 LQLFL 3 LQL+L Sbjct: 1028 LQLYL 1032