BLASTX nr result
ID: Cephaelis21_contig00017944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017944 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517786.1| alpha-n-acetylglucosaminidase, putative [Ric... 77 1e-12 emb|CBI24942.3| unnamed protein product [Vitis vinifera] 74 1e-11 ref|XP_002273084.1| PREDICTED: alpha-N-acetylglucosaminidase-lik... 74 1e-11 ref|XP_004135943.1| PREDICTED: alpha-N-acetylglucosaminidase-lik... 73 2e-11 emb|CAA77084.1| alpha-N-acetylglucosaminidase [Nicotiana tabacum] 73 3e-11 >ref|XP_002517786.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis] gi|223543058|gb|EEF44593.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis] Length = 174 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/58 (62%), Positives = 46/58 (79%) Frame = -1 Query: 176 ASSIQESEALEYLMNHLDSKSPHPSVQEAAARGVLERLLPTHLSSFEFQIVPKDICGG 3 A S + +E L++ LDSK PSVQE+AA+GVL+RLLPTH+ SFEF+IVPKD+CGG Sbjct: 24 ALSSSRVQPIEALLSRLDSKRSSPSVQESAAKGVLQRLLPTHVHSFEFEIVPKDVCGG 81 >emb|CBI24942.3| unnamed protein product [Vitis vinifera] Length = 868 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/57 (61%), Positives = 45/57 (78%) Frame = -1 Query: 173 SSIQESEALEYLMNHLDSKSPHPSVQEAAARGVLERLLPTHLSSFEFQIVPKDICGG 3 SS SEA+E L++ L +K PSVQE+AA+ VL+RLLPTHL SF+F+IV KD+CGG Sbjct: 83 SSSSHSEAIEALLSRLATKRAAPSVQESAAKAVLQRLLPTHLDSFQFEIVSKDVCGG 139 >ref|XP_002273084.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Vitis vinifera] Length = 803 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/57 (61%), Positives = 45/57 (78%) Frame = -1 Query: 173 SSIQESEALEYLMNHLDSKSPHPSVQEAAARGVLERLLPTHLSSFEFQIVPKDICGG 3 SS SEA+E L++ L +K PSVQE+AA+ VL+RLLPTHL SF+F+IV KD+CGG Sbjct: 18 SSSSHSEAIEALLSRLATKRAAPSVQESAAKAVLQRLLPTHLDSFQFEIVSKDVCGG 74 >ref|XP_004135943.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis sativus] Length = 774 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/56 (55%), Positives = 46/56 (82%) Frame = -1 Query: 170 SIQESEALEYLMNHLDSKSPHPSVQEAAARGVLERLLPTHLSSFEFQIVPKDICGG 3 ++ + EA++ +++ LDSK+ PS+QEAAA+ +L RLLPTH+ SFEFQIV +D+CGG Sbjct: 19 ALSQQEAIQAIIHRLDSKALSPSIQEAAAKALLRRLLPTHVDSFEFQIVSRDVCGG 74 >emb|CAA77084.1| alpha-N-acetylglucosaminidase [Nicotiana tabacum] Length = 811 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = -1 Query: 173 SSIQESEALEYLMNHLDSKSPHPSVQEAAARGVLERLLPTHLSSFEFQIVPKDICGG 3 SS ES+A+E ++ L SK P VQE+AA+GVL+RLLP HL SFEF+IV KD+CGG Sbjct: 20 SSAVESDAIESVLRRLHSKEAPPIVQESAAKGVLQRLLPAHLHSFEFKIVSKDLCGG 76