BLASTX nr result
ID: Cephaelis21_contig00017940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017940 (829 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC70889.1| hypothetical protein OsI_02427 [Oryza sativa Indi... 59 2e-06 >gb|EEC70889.1| hypothetical protein OsI_02427 [Oryza sativa Indica Group] Length = 1477 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = -2 Query: 555 GSKPELAPSGSMKAIVWNCRGLGGPSTVSQLREALRLHLPEVVFLEADAQRRQKLQ 388 G + AP G+M A+ WNCRGLG P TV +L +R++ P +VFL A Q ++++Q Sbjct: 436 GGRSRRAPPGTMNALAWNCRGLGRPCTVHELVRLVRMYSPRLVFLSATRQDQERVQ 491