BLASTX nr result
ID: Cephaelis21_contig00017794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017794 (889 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617715.1| Cytochrome P450 [Medicago truncatula] gi|355... 64 4e-18 ref|XP_002530922.1| cytochrome P450, putative [Ricinus communis]... 57 5e-17 ref|XP_003518544.1| PREDICTED: ABC transporter C family member 3... 58 8e-17 ref|XP_002264048.2| PREDICTED: cytochrome P450 71D11-like [Vitis... 57 8e-17 ref|XP_003556621.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 60 1e-16 >ref|XP_003617715.1| Cytochrome P450 [Medicago truncatula] gi|355519050|gb|AET00674.1| Cytochrome P450 [Medicago truncatula] Length = 501 Score = 64.3 bits (155), Expect(2) = 4e-18 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = -1 Query: 490 ITMGDGRRICLGIWYSQPINELLLAQLLFHFDWNLQDGLKHEELEMNKNF 341 I G GRR+CLGI ++ P EL LAQLL+HFDW L +G+K+EEL+M ++F Sbjct: 433 IPFGAGRRMCLGIAFALPNIELPLAQLLYHFDWKLPNGMKNEELDMTESF 482 Score = 53.5 bits (127), Expect(2) = 4e-18 Identities = 20/35 (57%), Positives = 28/35 (80%) Frame = -3 Query: 584 IIVNAWAMGRDPKYWSEAQKFHLEKFSNSEVDYNG 480 +IVNAWA+GRDP+YW +A+ F E+F NS +D+ G Sbjct: 393 VIVNAWAIGRDPRYWVDAKSFKPERFLNSRIDFKG 427 >ref|XP_002530922.1| cytochrome P450, putative [Ricinus communis] gi|223529516|gb|EEF31471.1| cytochrome P450, putative [Ricinus communis] Length = 438 Score = 57.4 bits (137), Expect(2) = 5e-17 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -3 Query: 623 EIGNDENPVMVEIIIVNAWAMGRDPKYWSEAQKFHLEKFSNSEVDYNG 480 E+ E PV ++I VNAWA+GRDP+YW+EA+KF E+F ++ +DY G Sbjct: 318 EVCGYEIPVNAKVI-VNAWAIGRDPRYWNEAEKFFPERFLDNSIDYKG 364 Score = 57.0 bits (136), Expect(2) = 5e-17 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = -1 Query: 496 KLITMGDGRRICLGIWYSQPINELLLAQLLFHFDWNLQDGLKHEELEMNKNF 341 + I G GRR+C GI Y + EL LA LL+HFDW L DG++ ++ +M+++F Sbjct: 368 EFIPFGAGRRMCPGISYGMAVIELSLANLLYHFDWKLPDGMEPKDFDMSESF 419 >ref|XP_003518544.1| PREDICTED: ABC transporter C family member 3-like [Glycine max] Length = 2054 Score = 58.2 bits (139), Expect(2) = 8e-17 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -1 Query: 496 KLITMGDGRRICLGIWYSQPINELLLAQLLFHFDWNLQDGLKHEELEMNKNF 341 + I G GRRIC GI ++ P EL LA LL+HFDW L + +K+EEL+M +++ Sbjct: 436 EFIPFGAGRRICPGISFATPNIELPLAHLLYHFDWKLPNNMKNEELDMTESY 487 Score = 55.5 bits (132), Expect(2) = 8e-17 Identities = 20/35 (57%), Positives = 28/35 (80%) Frame = -3 Query: 584 IIVNAWAMGRDPKYWSEAQKFHLEKFSNSEVDYNG 480 + +NAWA+GRDPKYW+EA+ F E+F NS +D+ G Sbjct: 398 VFINAWAIGRDPKYWTEAESFKPERFLNSSIDFKG 432 >ref|XP_002264048.2| PREDICTED: cytochrome P450 71D11-like [Vitis vinifera] Length = 485 Score = 57.0 bits (136), Expect(2) = 8e-17 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -1 Query: 490 ITMGDGRRICLGIWYSQPINELLLAQLLFHFDWNLQDGLKHEELEMNKNF 341 I G GRRIC GI + ELLLA+LL+HFDW L +G+K ++L+M + F Sbjct: 413 IPFGAGRRICPGILFGLASVELLLAKLLYHFDWKLPNGMKQQDLDMTEVF 462 Score = 56.6 bits (135), Expect(2) = 8e-17 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = -3 Query: 623 EIGNDENPVMVEIIIVNAWAMGRDPKYWSEAQKFHLEKFSNSEVDYNG 480 EI E PV +II VNAWA+GRDPK+W+E + F+ E+F +S +DY G Sbjct: 361 EIDGHEIPVKSKII-VNAWAIGRDPKHWTEPESFNPERFLDSSIDYKG 407 >ref|XP_003556621.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D11-like [Glycine max] Length = 447 Score = 60.5 bits (145), Expect(2) = 1e-16 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = -3 Query: 587 IIIVNAWAMGRDPKYWSEAQKFHLEKFSNSEVDYNG 480 ++IVNAWA+GRDPKYWSEA++F+ E+F +S +DY G Sbjct: 331 MVIVNAWAIGRDPKYWSEAERFYPERFIDSSIDYKG 366 Score = 52.4 bits (124), Expect(2) = 1e-16 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = -1 Query: 490 ITMGDGRRICLGIWYSQPINELLLAQLLFHFDWNLQDGLKHEELEMNK 347 I G GRRIC G + EL LA LLFHFDW L +G+K+E+L+M + Sbjct: 372 IPFGAGRRICPGSTFGLKNVELALAFLLFHFDWKLPNGMKNEDLDMTE 419