BLASTX nr result
ID: Cephaelis21_contig00017711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017711 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526530.1| suppression of tumorigenicity, putative [Ric... 60 2e-07 ref|XP_002301838.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_003558825.1| PREDICTED: uncharacterized protein LOC100831... 55 6e-06 >ref|XP_002526530.1| suppression of tumorigenicity, putative [Ricinus communis] gi|223534091|gb|EEF35808.1| suppression of tumorigenicity, putative [Ricinus communis] Length = 765 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/41 (56%), Positives = 35/41 (85%) Frame = +1 Query: 310 VKMSNVPVLPGYKELISKLQPFHTRMSRKGSVAQRHPIYKC 432 VKM ++P LP YKEL+S+L PFH+R+S + S+A++HP+Y+C Sbjct: 662 VKMCHLPALPRYKELVSELAPFHSRLSFQSSIARKHPVYRC 702 >ref|XP_002301838.1| predicted protein [Populus trichocarpa] gi|222843564|gb|EEE81111.1| predicted protein [Populus trichocarpa] Length = 656 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +1 Query: 310 VKMSNVPVLPGYKELISKLQPFHTRMSRKGSVAQRHPIYKC 432 VKM ++P LP YKEL+S+L+P H R+S + SVA+RHP+Y+C Sbjct: 537 VKMCHLPTLPRYKELVSELRPLHDRLSLESSVAKRHPVYRC 577 >ref|XP_003558825.1| PREDICTED: uncharacterized protein LOC100831773 [Brachypodium distachyon] Length = 920 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 310 VKMSNVPVLPGYKELISKLQPFHTRMSRKGSVAQRHPIYKC 432 VK S+VP LP YKEL+S L P H R+S + ++A++HPIY+C Sbjct: 783 VKASSVPQLPRYKELVSDLSPIHARLSCEDALAKKHPIYRC 823