BLASTX nr result
ID: Cephaelis21_contig00017648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017648 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD21635.1| matrix metalloprotease 1 [Nicotiana benthamiana] 85 7e-15 emb|CCH68442.1| matrix metalloproteinase precursor [Solanum lyco... 84 1e-14 gb|ABF58910.1| matrix metalloprotease 1 [Nicotiana tabacum] 81 8e-14 emb|CCH68443.1| matrix metalloproteinase precursor [Solanum lyco... 77 1e-12 ref|XP_002520211.1| Metalloendoproteinase 1 precursor, putative ... 70 2e-10 >gb|ADD21635.1| matrix metalloprotease 1 [Nicotiana benthamiana] Length = 364 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = +2 Query: 116 TPTSAHFFPNISSIPGSLIPNTTSWDSFIKFLGCHSGQKVEGLAKLKKYF 265 +P SAHFFPNISSIP L PN T+WD+F K LGCH+GQKV+GLAK+KKYF Sbjct: 16 SPASAHFFPNISSIPPLLKPNNTAWDAFHKLLGCHAGQKVDGLAKIKKYF 65 >emb|CCH68442.1| matrix metalloproteinase precursor [Solanum lycopersicum] Length = 367 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/52 (73%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = +2 Query: 113 PTPTSAHFFPNISSIPGSLI-PNTTSWDSFIKFLGCHSGQKVEGLAKLKKYF 265 P P+SAHFFPNISSIP +L+ PN T+WD+F K LGCHSGQ V+GLAK+KKYF Sbjct: 16 PFPSSAHFFPNISSIPPNLLKPNATAWDAFNKLLGCHSGQTVDGLAKIKKYF 67 >gb|ABF58910.1| matrix metalloprotease 1 [Nicotiana tabacum] Length = 365 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/51 (72%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = +2 Query: 116 TPTSAHFFPNISSIPGSLI-PNTTSWDSFIKFLGCHSGQKVEGLAKLKKYF 265 +P SAHF PNISSIP SL+ PN T+WD+F K LGCH+GQKV+GLAK+KKYF Sbjct: 16 SPASAHFSPNISSIPPSLLKPNNTAWDAFHKLLGCHAGQKVDGLAKIKKYF 66 >emb|CCH68443.1| matrix metalloproteinase precursor [Solanum lycopersicum] Length = 363 Score = 77.0 bits (188), Expect = 1e-12 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +2 Query: 116 TPTSAHFFPNISSIPGSLI-PNTTSWDSFIKFLGCHSGQKVEGLAKLKKYF 265 T SAHFFPNISSIP SL+ PN T+W SF K LGC GQKV+G+AK+KKYF Sbjct: 18 TSCSAHFFPNISSIPSSLLKPNATAWTSFQKLLGCQPGQKVDGIAKIKKYF 68 >ref|XP_002520211.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] gi|223540703|gb|EEF42266.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] Length = 364 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +2 Query: 122 TSAHFFPNISSIPGSLIPNTTS--WDSFIKFLGCHSGQKVEGLAKLKKYF 265 TSA FFPN+SSIP +L+PN TS WDSF + GC +G K+EGL+KLK YF Sbjct: 20 TSARFFPNVSSIPPNLLPNITSPTWDSFKRLAGCRAGDKLEGLSKLKNYF 69