BLASTX nr result
ID: Cephaelis21_contig00017617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017617 (576 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77347.1| hypothetical protein VITISV_025746 [Vitis vinifera] 77 3e-12 emb|CAN73690.1| hypothetical protein VITISV_034834 [Vitis vinifera] 76 5e-12 gb|AAW28578.1| Putative gag-pol polyprotein, identical [Solanum ... 72 5e-11 gb|AAW28577.1| Putative gag-pol polyprotein, identical [Solanum ... 72 5e-11 emb|CAN63671.1| hypothetical protein VITISV_006425 [Vitis vinifera] 70 2e-10 >emb|CAN77347.1| hypothetical protein VITISV_025746 [Vitis vinifera] Length = 556 Score = 76.6 bits (187), Expect = 3e-12 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = +3 Query: 399 PMTKHLSPF*LQWITDSGGVKVNRQCLVNFKIRKYRDEALCDIAPIEAGHILLG*PW 569 P KH P+ LQW+ DSG V+V +Q LV+F+I KY D+ LCD+ P++ GH+LLG PW Sbjct: 131 PTIKHPRPYKLQWLNDSGEVRVTKQVLVSFRIMKYEDQVLCDVIPMQVGHLLLGQPW 187 >emb|CAN73690.1| hypothetical protein VITISV_034834 [Vitis vinifera] Length = 818 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/57 (57%), Positives = 41/57 (71%) Frame = +3 Query: 399 PMTKHLSPF*LQWITDSGGVKVNRQCLVNFKIRKYRDEALCDIAPIEAGHILLG*PW 569 P KH P+ LQW+ D G KVN++ LV+F I +Y+DE LCDI P+ AGHILLG PW Sbjct: 451 PTLKHPRPYKLQWLNDFGEDKVNKEVLVSFSIGRYKDEVLCDIVPMHAGHILLGRPW 507 >gb|AAW28578.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1588 Score = 72.4 bits (176), Expect = 5e-11 Identities = 27/54 (50%), Positives = 41/54 (75%) Frame = +3 Query: 408 KHLSPF*LQWITDSGGVKVNRQCLVNFKIRKYRDEALCDIAPIEAGHILLG*PW 569 K +P+ LQW+ D G V+VN+QC+++F + +Y DE LCD+ P++A H+LLG PW Sbjct: 461 KRSTPYRLQWLNDCGEVQVNKQCMISFNVGRYEDEILCDVVPMQACHVLLGRPW 514 >gb|AAW28577.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1588 Score = 72.4 bits (176), Expect = 5e-11 Identities = 27/54 (50%), Positives = 41/54 (75%) Frame = +3 Query: 408 KHLSPF*LQWITDSGGVKVNRQCLVNFKIRKYRDEALCDIAPIEAGHILLG*PW 569 K +P+ LQW+ D G V+VN+QC+++F + +Y DE LCD+ P++A H+LLG PW Sbjct: 461 KRSTPYRLQWLNDCGEVQVNKQCMISFNVGRYEDEILCDVVPMQACHVLLGRPW 514 >emb|CAN63671.1| hypothetical protein VITISV_006425 [Vitis vinifera] Length = 537 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = +3 Query: 399 PMTKHLSPF*LQWITDSGGVKVNRQCLVNFKIRKYRDEALCDIAPIEAGHILLG*PW 569 P H P+ LQW+ DSG V+V ++ LV+F I+KY DE LCDI ++ GH+LLG PW Sbjct: 204 PTIIHPRPYKLQWLNDSGEVRVTKKVLVSFCIKKYEDEVLCDIVSMQVGHLLLGRPW 260