BLASTX nr result
ID: Cephaelis21_contig00017615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017615 (792 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004141968.1| PREDICTED: uncharacterized protein LOC101208... 58 3e-06 >ref|XP_004141968.1| PREDICTED: uncharacterized protein LOC101208394 [Cucumis sativus] Length = 362 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +1 Query: 595 LWQGIVYNQLDKEKEALKQYEIHQSFVPD*SPQRKFVDDVRLAA 726 L QGI+Y+ LDK+KEA +Q+E +Q+ VPD PQR+F+DDV L+A Sbjct: 299 LCQGIIYSLLDKKKEAAEQFETYQALVPDEFPQREFIDDVMLSA 342