BLASTX nr result
ID: Cephaelis21_contig00017468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017468 (1729 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82281.1| hypothetical protein VITISV_029783 [Vitis vinifera] 74 2e-10 ref|XP_002266845.1| PREDICTED: enhancer of polycomb homolog 2 [V... 70 1e-09 ref|XP_002513287.1| transcription factor, putative [Ricinus comm... 65 7e-08 emb|CAN79466.1| hypothetical protein VITISV_022577 [Vitis vinifera] 62 5e-07 >emb|CAN82281.1| hypothetical protein VITISV_029783 [Vitis vinifera] Length = 253 Score = 73.6 bits (179), Expect = 2e-10 Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 3/112 (2%) Frame = +1 Query: 1330 LRHR*TESHLVMLANLALQRHRIDQ*FTLVAENQFVRIVLVLSGLPSFPAKAVSSEEEFV 1509 LR R + VM + ++LQR +I E + + L L G P+FP K SSEEEFV Sbjct: 62 LRQREEKKRDVMESEVSLQRIQIKY----KHETELLDDSLALPGFPTFPCKIGSSEEEFV 117 Query: 1510 DSDHIANSRPCMWLAAVQHPPVADSKLGMAFAGSTSRELKR---PNGWLIKL 1656 DSD +ANSRP + Q+ + DSKL M G+ REL+R P GWL K+ Sbjct: 118 DSDDVANSRPHIRPTVGQNXSLVDSKLVMISGGNLRRELRRQHVPQGWLNKM 169 >ref|XP_002266845.1| PREDICTED: enhancer of polycomb homolog 2 [Vitis vinifera] gi|296084848|emb|CBI27730.3| unnamed protein product [Vitis vinifera] Length = 453 Score = 70.5 bits (171), Expect = 1e-09 Identities = 45/102 (44%), Positives = 59/102 (57%), Gaps = 3/102 (2%) Frame = +1 Query: 1360 VMLANLALQRHRIDQ*FTLVAENQFVRIVLVLSGLPSFPAKAVSSEEEFVDSDHIANSRP 1539 VM + ++LQR +I E + + L L G P+FP K SSEEEFVDSD +ANSRP Sbjct: 272 VMESEVSLQRIQIKY----KHETELLDDSLALPGFPTFPCKIGSSEEEFVDSDDVANSRP 327 Query: 1540 CMWLAAVQHPPVADSKLGMAFAGSTSRELKR---PNGWLIKL 1656 + Q+ + DSKL M G+ REL+R P GWL K+ Sbjct: 328 HIRPTVGQNLSLVDSKLVMISGGNLRRELRRQHVPQGWLNKM 369 >ref|XP_002513287.1| transcription factor, putative [Ricinus communis] gi|223547195|gb|EEF48690.1| transcription factor, putative [Ricinus communis] Length = 454 Score = 64.7 bits (156), Expect = 7e-08 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 3/81 (3%) Frame = +1 Query: 1423 ENQFVRIVLVLSGLPSFPAKAVSSEEEFVDSDHIANSRPCMWLAAVQHPPVADSKLGMAF 1602 E + + LVL G P +K SSE+EFVDSD +ANSRP LAA Q+PP DS Sbjct: 293 ETELLEDSLVLPGFPPISSKFASSEDEFVDSDDLANSRPRARLAASQNPPFMDSL--TVP 350 Query: 1603 AGSTSRELKR---PNGWLIKL 1656 AGS +E +R P GWL K+ Sbjct: 351 AGSVKQEFRRRHSPYGWLNKM 371 >emb|CAN79466.1| hypothetical protein VITISV_022577 [Vitis vinifera] Length = 648 Score = 62.0 bits (149), Expect = 5e-07 Identities = 33/70 (47%), Positives = 43/70 (61%) Frame = +1 Query: 1423 ENQFVRIVLVLSGLPSFPAKAVSSEEEFVDSDHIANSRPCMWLAAVQHPPVADSKLGMAF 1602 E + + L L G P+ P K SSEEEFVDSD +ANS + A Q+P + +SKL M F Sbjct: 489 ETELLDDSLALPGFPTLPCKIGSSEEEFVDSDDVANSHLHIQPAVGQNPSLVBSKLVMVF 548 Query: 1603 AGSTSRELKR 1632 GS +EL+R Sbjct: 549 GGSLRQELRR 558