BLASTX nr result
ID: Cephaelis21_contig00017291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017291 (1127 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304011.1| predicted protein [Populus trichocarpa] gi|2... 62 3e-07 emb|CCH50968.1| T4.7 [Malus x robusta] 60 1e-06 ref|XP_002283435.1| PREDICTED: GPI mannosyltransferase 2 [Vitis ... 60 1e-06 gb|AAC17633.1| Contains similarity to hypothetical protein C18b1... 59 2e-06 ref|NP_172652.2| phosphatidylinositol glycan, class V [Arabidops... 59 2e-06 >ref|XP_002304011.1| predicted protein [Populus trichocarpa] gi|222841443|gb|EEE78990.1| predicted protein [Populus trichocarpa] Length = 483 Score = 62.0 bits (149), Expect = 3e-07 Identities = 23/41 (56%), Positives = 34/41 (82%) Frame = -2 Query: 124 QCQLALQVIVSGAFRCLCIFIPFFSFQAFGYFNICRGHAED 2 + LA++V++ GA RC+CIFIPF ++QA+GY+NIC GH+ D Sbjct: 244 RAHLAVKVLIVGALRCICIFIPFIAYQAYGYYNICHGHSLD 284 >emb|CCH50968.1| T4.7 [Malus x robusta] Length = 548 Score = 59.7 bits (143), Expect = 1e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 115 LALQVIVSGAFRCLCIFIPFFSFQAFGYFNICRGH 11 LALQ +V GA RC+CIF+PF +FQA+GY N+C GH Sbjct: 250 LALQAVVGGALRCICIFVPFIAFQAYGYNNLCLGH 284 >ref|XP_002283435.1| PREDICTED: GPI mannosyltransferase 2 [Vitis vinifera] gi|297746434|emb|CBI16490.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 59.7 bits (143), Expect = 1e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -2 Query: 115 LALQVIVSGAFRCLCIFIPFFSFQAFGYFNICRGHAED 2 L++QV++ G RCLCIF+PF +FQA+GY+NIC GH D Sbjct: 244 LSVQVLLVGVLRCLCIFVPFVAFQAYGYYNICLGHFPD 281 >gb|AAC17633.1| Contains similarity to hypothetical protein C18b11.05 gb|Z50728 from S. pombe. EST gb|H76601 comes from this gene [Arabidopsis thaliana] Length = 492 Score = 59.3 bits (142), Expect = 2e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = -2 Query: 115 LALQVIVSGAFRCLCIFIPFFSFQAFGYFNICRGHAED 2 LA+QV ++G RC+CI +PF +FQA+GY+NIC GH D Sbjct: 246 LAMQVFIAGFLRCICICLPFVAFQAYGYYNICHGHTRD 283 >ref|NP_172652.2| phosphatidylinositol glycan, class V [Arabidopsis thaliana] gi|46931244|gb|AAT06426.1| At1g11880 [Arabidopsis thaliana] gi|50897228|gb|AAT85753.1| At1g11880 [Arabidopsis thaliana] gi|332190687|gb|AEE28808.1| phosphatidylinositol glycan, class V [Arabidopsis thaliana] Length = 489 Score = 59.3 bits (142), Expect = 2e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = -2 Query: 115 LALQVIVSGAFRCLCIFIPFFSFQAFGYFNICRGHAED 2 LA+QV ++G RC+CI +PF +FQA+GY+NIC GH D Sbjct: 246 LAMQVFIAGFLRCICICLPFVAFQAYGYYNICHGHTRD 283