BLASTX nr result
ID: Cephaelis21_contig00016858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016858 (2230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g... 67 2e-08 ref|XP_002532938.1| nucleic acid binding protein, putative [Rici... 67 2e-08 ref|XP_002299073.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-07 ref|NP_200425.1| RNA-binding KH domain-containing protein [Arabi... 63 3e-07 ref|XP_002864436.1| KH domain-containing protein [Arabidopsis ly... 63 3e-07 >ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g56140 isoform 1 [Vitis vinifera] gi|296089986|emb|CBI39805.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 67.4 bits (163), Expect = 2e-08 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 555 VEHEKYLAELLAERHKLSPFMPVLPHTYRLLNQSRLEI 668 VE EKYL+ELLAERHKLSPFMPVLPH+YRLLNQ L + Sbjct: 33 VEQEKYLSELLAERHKLSPFMPVLPHSYRLLNQEILRV 70 >ref|XP_002532938.1| nucleic acid binding protein, putative [Ricinus communis] gi|223527289|gb|EEF29442.1| nucleic acid binding protein, putative [Ricinus communis] Length = 300 Score = 67.0 bits (162), Expect = 2e-08 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 555 VEHEKYLAELLAERHKLSPFMPVLPHTYRLLNQSRLEI 668 VE EKYL+ELLAERHKLSPFMPVLPHTYRLL+Q L + Sbjct: 43 VEQEKYLSELLAERHKLSPFMPVLPHTYRLLSQEILRV 80 >ref|XP_002299073.1| predicted protein [Populus trichocarpa] gi|222846331|gb|EEE83878.1| predicted protein [Populus trichocarpa] Length = 302 Score = 64.3 bits (155), Expect = 1e-07 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 555 VEHEKYLAELLAERHKLSPFMPVLPHTYRLLNQSRLEI 668 VE EKYL+ELLAERHK+SPF+PVLP+TYRLLNQ L + Sbjct: 45 VEQEKYLSELLAERHKISPFLPVLPNTYRLLNQEILRV 82 >ref|NP_200425.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] gi|75262628|sp|Q9FKT4.1|QKIL2_ARATH RecName: Full=KH domain-containing protein At5g56140; AltName: Full=Quaking-like protein 2 gi|9758634|dbj|BAB09296.1| RNA-binding protein-like [Arabidopsis thaliana] gi|24030184|gb|AAN41273.1| putative RNA-binding protein [Arabidopsis thaliana] gi|332009342|gb|AED96725.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] Length = 315 Score = 63.2 bits (152), Expect = 3e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 555 VEHEKYLAELLAERHKLSPFMPVLPHTYRLLNQSRLEI 668 VE EKYL+ELLAERHKL+PF+PVLPH +RLLNQ L + Sbjct: 60 VEQEKYLSELLAERHKLTPFLPVLPHAFRLLNQEILRV 97 >ref|XP_002864436.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297310271|gb|EFH40695.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 308 Score = 63.2 bits (152), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 555 VEHEKYLAELLAERHKLSPFMPVLPHTYRLLNQ 653 VE EKYL+ELLAERHKL+PF+PVLPH YRLLNQ Sbjct: 54 VEQEKYLSELLAERHKLTPFLPVLPHAYRLLNQ 86