BLASTX nr result
ID: Cephaelis21_contig00016815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016815 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ55276.1| expansin [Breonia chinensis] gi|351630273|gb|AEQ5... 75 4e-12 ref|XP_002306037.1| hypothetical protein POPTRDRAFT_556331 [Popu... 73 2e-11 ref|XP_002283741.1| PREDICTED: expansin-A1 [Vitis vinifera] gi|1... 73 2e-11 gb|AAM89261.1|AF527800_1 expansin 3 [Malus x domestica] 73 2e-11 ref|XP_002533125.1| Alpha-expansin 5 precursor, putative [Ricinu... 72 4e-11 >gb|AEQ55276.1| expansin [Breonia chinensis] gi|351630273|gb|AEQ55291.1| expansin [Breonia chinensis] Length = 240 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -2 Query: 132 MLILGVFILGLISAVSPVQGYYGGWTRAHATFYGGGDASGTMGG 1 M ILG F++GL S VS V GYYGGW AHATFYGGGDASGTMGG Sbjct: 1 MHILGFFLVGLFSVVSSVHGYYGGWITAHATFYGGGDASGTMGG 44 >ref|XP_002306037.1| hypothetical protein POPTRDRAFT_556331 [Populus trichocarpa] gi|222849001|gb|EEE86548.1| hypothetical protein POPTRDRAFT_556331 [Populus trichocarpa] Length = 241 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -2 Query: 132 MLILGVFILGLISAVSPVQGYYGGWTRAHATFYGGGDASGTMGG 1 M +LG ++G +S+VS V GYYGGW AHATFYGGGDASGTMGG Sbjct: 1 MALLGFLLVGFLSSVSSVHGYYGGWINAHATFYGGGDASGTMGG 44 >ref|XP_002283741.1| PREDICTED: expansin-A1 [Vitis vinifera] gi|147864216|emb|CAN78812.1| hypothetical protein VITISV_012111 [Vitis vinifera] gi|296082937|emb|CBI22238.3| unnamed protein product [Vitis vinifera] Length = 240 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -2 Query: 132 MLILGVFILGLISAVSPVQGYYGGWTRAHATFYGGGDASGTMGG 1 M +LG ++G++S VS V GYYGGW AHATFYGGGDASGTMGG Sbjct: 1 MALLGFLLVGILSMVSAVNGYYGGWINAHATFYGGGDASGTMGG 44 >gb|AAM89261.1|AF527800_1 expansin 3 [Malus x domestica] Length = 241 Score = 73.2 bits (178), Expect = 2e-11 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 132 MLILGVFILGLISAVSPVQGYYGGWTRAHATFYGGGDASGTMGG 1 M G+ ++G +S VS V GYYGGW+ AHATFYGGGDASGTMGG Sbjct: 1 MAFFGILVIGFLSLVSSVNGYYGGWSNAHATFYGGGDASGTMGG 44 >ref|XP_002533125.1| Alpha-expansin 5 precursor, putative [Ricinus communis] gi|223527088|gb|EEF29270.1| Alpha-expansin 5 precursor, putative [Ricinus communis] Length = 241 Score = 72.4 bits (176), Expect = 4e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 132 MLILGVFILGLISAVSPVQGYYGGWTRAHATFYGGGDASGTMGG 1 M +LG ++G +S VS V GYYGGW AHATFYGGGDASGTMGG Sbjct: 1 MALLGFLLVGFLSIVSSVHGYYGGWINAHATFYGGGDASGTMGG 44