BLASTX nr result
ID: Cephaelis21_contig00016813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016813 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR24115.1| eugenol synthase 1 [Petunia x hybrida] 64 1e-08 ref|XP_002283921.1| PREDICTED: isoflavone reductase homolog [Vit... 64 1e-08 gb|AAF64174.1|AF242491_1 phenylcoumaran benzylic ether reductase... 64 2e-08 sp|E1U332.1|ALL12_OLEEU RecName: Full=Isoflavone reductase-like ... 64 2e-08 ref|XP_002302025.1| phenylcoumaran benzylic ether reductase 1 [P... 63 2e-08 >gb|ABR24115.1| eugenol synthase 1 [Petunia x hybrida] Length = 308 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -3 Query: 325 VNGDTTNFAIEPSFGVEASELYADVKYTTVEEYIEKLA 212 V GD TNF IEPSFGVEASELY DVKYTTVEEY+ A Sbjct: 271 VKGDQTNFVIEPSFGVEASELYPDVKYTTVEEYLSHFA 308 >ref|XP_002283921.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744407|emb|CBI37669.3| unnamed protein product [Vitis vinifera] Length = 306 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 331 ILVNGDTTNFAIEPSFGVEASELYADVKYTTVEEYIEKLA 212 + + GD TNF IEPSFGVEASELY DVKYTTV+EY+ + A Sbjct: 267 VFIEGDQTNFEIEPSFGVEASELYPDVKYTTVDEYLNQFA 306 >gb|AAF64174.1|AF242491_1 phenylcoumaran benzylic ether reductase homolog Fi1 [Forsythia x intermedia] Length = 308 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 331 ILVNGDTTNFAIEPSFGVEASELYADVKYTTVEEYI 224 + V GD TNF IEPSFGVEASELY DVKYTTVEEY+ Sbjct: 269 VFVKGDLTNFKIEPSFGVEASELYPDVKYTTVEEYL 304 >sp|E1U332.1|ALL12_OLEEU RecName: Full=Isoflavone reductase-like protein; AltName: Full=Pollen allergen Ole e 12.01; AltName: Allergen=Ole e 12.01 gi|218963723|gb|ACL13551.1| Ole e 12.01 allergen [Olea europaea] Length = 308 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 325 VNGDTTNFAIEPSFGVEASELYADVKYTTVEEYIEK 218 V GD TNF IEPSFGVEASELY DVKYTTVEEY+++ Sbjct: 271 VKGDLTNFKIEPSFGVEASELYPDVKYTTVEEYLDQ 306 >ref|XP_002302025.1| phenylcoumaran benzylic ether reductase 1 [Populus trichocarpa] gi|3114901|emb|CAA06707.1| phenylcoumaran benzylic ether reductase [Populus trichocarpa] gi|3114905|emb|CAA06709.1| phenylcoumaran benzylic ether reductase [Populus trichocarpa] gi|5805052|emb|CAB53542.1| phenylcoumaran benzylic ether reductase [Populus trichocarpa] gi|118485308|gb|ABK94513.1| unknown [Populus trichocarpa] gi|222843751|gb|EEE81298.1| phenylcoumaran benzylic ether reductase 1 [Populus trichocarpa] Length = 308 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 328 LVNGDTTNFAIEPSFGVEASELYADVKYTTVEEYIEK 218 LVNGD TNF I+PS+G+EASELY DVKYTTVEEY+++ Sbjct: 270 LVNGDMTNFEIDPSWGLEASELYPDVKYTTVEEYLDQ 306