BLASTX nr result
ID: Cephaelis21_contig00016584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016584 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACE79513.1| NBS-coding resistance gene analog [Nicotiana taba... 69 3e-10 gb|ACE79512.1| NBS-coding resistance gene analog [Nicotiana taba... 69 3e-10 gb|ACE79511.1| NBS-coding resistance gene analog [Nicotiana taba... 69 3e-10 gb|ACE79510.1| NBS-coding resistance gene analog [Nicotiana taba... 69 3e-10 gb|ACE79509.1| NBS-coding resistance gene analog [Nicotiana taba... 69 3e-10 >gb|ACE79513.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 252 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = -2 Query: 196 STPTMTNEVVGLCDEATSIIHQITRGSKQLRIIAIVGMPGIGKTTLASKVYNDPSVRCRF 17 S P++ EVVG +A SI+ ++ G+K+L +I+I GMPG+GKTTLA KVYN+PS+ F Sbjct: 26 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 85 Query: 16 SAFAW 2 A W Sbjct: 86 DARVW 90 >gb|ACE79512.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 249 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = -2 Query: 196 STPTMTNEVVGLCDEATSIIHQITRGSKQLRIIAIVGMPGIGKTTLASKVYNDPSVRCRF 17 S P++ EVVG +A SI+ ++ G+K+L +I+I GMPG+GKTTLA KVYN+PS+ F Sbjct: 26 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 85 Query: 16 SAFAW 2 A W Sbjct: 86 DARVW 90 >gb|ACE79511.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 245 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = -2 Query: 196 STPTMTNEVVGLCDEATSIIHQITRGSKQLRIIAIVGMPGIGKTTLASKVYNDPSVRCRF 17 S P++ EVVG +A SI+ ++ G+K+L +I+I GMPG+GKTTLA KVYN+PS+ F Sbjct: 19 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 78 Query: 16 SAFAW 2 A W Sbjct: 79 DARVW 83 >gb|ACE79510.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 250 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = -2 Query: 196 STPTMTNEVVGLCDEATSIIHQITRGSKQLRIIAIVGMPGIGKTTLASKVYNDPSVRCRF 17 S P++ EVVG +A SI+ ++ G+K+L +I+I GMPG+GKTTLA KVYN+PS+ F Sbjct: 26 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 85 Query: 16 SAFAW 2 A W Sbjct: 86 DARVW 90 >gb|ACE79509.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 252 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = -2 Query: 196 STPTMTNEVVGLCDEATSIIHQITRGSKQLRIIAIVGMPGIGKTTLASKVYNDPSVRCRF 17 S P++ EVVG +A SI+ ++ G+K+L +I+I GMPG+GKTTLA KVYN+PS+ F Sbjct: 27 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 86 Query: 16 SAFAW 2 A W Sbjct: 87 DARVW 91