BLASTX nr result
ID: Cephaelis21_contig00016557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016557 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528273.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 gb|ACZ98537.1| PPR motif protein [Malus x domestica] 62 5e-08 ref|XP_003628782.1| Pentatricopeptide repeat-containing protein ... 61 1e-07 emb|CBI28135.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002281645.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 >ref|XP_003528273.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Glycine max] Length = 805 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +2 Query: 2 KQKGLKKSPGCSWIQIGVEHHVFVARDRSHLDTEKIYAMLSLL 130 K+KGL+K PGCSWI++G E HVF+A DRSH TE+IY L LL Sbjct: 758 KEKGLRKIPGCSWIEVGQELHVFIASDRSHPKTEEIYVTLDLL 800 >gb|ACZ98537.1| PPR motif protein [Malus x domestica] Length = 751 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +2 Query: 2 KQKGLKKSPGCSWIQIGVEHHVFVARDRSHLDTEKIYAMLSLL 130 K++GL+K PGCSWIQ+G E +VFVA D+SH +TE+IY L+LL Sbjct: 702 KERGLRKIPGCSWIQVGEELNVFVAGDKSHPETEEIYTTLALL 744 >ref|XP_003628782.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522804|gb|AET03258.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1002 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +2 Query: 2 KQKGLKKSPGCSWIQIGVEHHVFVARDRSHLDTEKIYAMLSLL 130 K+KGLKK PGCSWI++G E +VF+A D+SH + E+IY +L LL Sbjct: 818 KEKGLKKIPGCSWIEVGQELNVFIASDKSHPEKEEIYKILDLL 860 >emb|CBI28135.3| unnamed protein product [Vitis vinifera] Length = 1974 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/48 (56%), Positives = 39/48 (81%) Frame = +2 Query: 2 KQKGLKKSPGCSWIQIGVEHHVFVARDRSHLDTEKIYAMLSLLETDLQ 145 K +GL+K+PGCSWIQ G + +VFVA D SH TE+IYAML++L ++++ Sbjct: 1880 KVRGLRKNPGCSWIQTGGKLNVFVAGDGSHPKTEEIYAMLAMLLSEMR 1927 >ref|XP_002281645.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Vitis vinifera] Length = 858 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/48 (56%), Positives = 39/48 (81%) Frame = +2 Query: 2 KQKGLKKSPGCSWIQIGVEHHVFVARDRSHLDTEKIYAMLSLLETDLQ 145 K +GL+K+PGCSWIQ G + +VFVA D SH TE+IYAML++L ++++ Sbjct: 785 KVRGLRKNPGCSWIQTGGKLNVFVAGDGSHPKTEEIYAMLAMLLSEMR 832