BLASTX nr result
ID: Cephaelis21_contig00016514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016514 (1468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528123.1| PREDICTED: callose synthase 10-like [Glycine... 61 9e-07 >ref|XP_003528123.1| PREDICTED: callose synthase 10-like [Glycine max] Length = 1901 Score = 60.8 bits (146), Expect = 9e-07 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = +2 Query: 311 LQIKPLVQPTNKMVHLPSLQYSWHDLASKSECSFSFALFCILKLMFPFVALDLNNFSAF 487 LQIKPLV+PTN +VHLPSL YSWHDL S++ ++ F IL L P VA+ L + F Sbjct: 678 LQIKPLVEPTNIIVHLPSLPYSWHDLISRN----NYNAFTILSLWAPVVAIYLMDILIF 732