BLASTX nr result
ID: Cephaelis21_contig00015039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015039 (493 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146040.1| PREDICTED: RNA exonuclease 4-like [Cucumis s... 64 1e-08 gb|ADN33800.1| RNA exonuclease [Cucumis melo subsp. melo] 64 1e-08 ref|XP_003543225.1| PREDICTED: RNA exonuclease 4-like [Glycine max] 62 4e-08 ref|XP_003539610.1| PREDICTED: RNA exonuclease 4-like [Glycine max] 62 4e-08 gb|ACU17880.1| unknown [Glycine max] 62 4e-08 >ref|XP_004146040.1| PREDICTED: RNA exonuclease 4-like [Cucumis sativus] gi|449510336|ref|XP_004163636.1| PREDICTED: RNA exonuclease 4-like [Cucumis sativus] Length = 263 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 404 VNKWGNVIYDEYVRPVERVVDFRTQISGIR 493 VNKWGNVIYDE+VRP+ERVVDFRTQISGIR Sbjct: 102 VNKWGNVIYDEFVRPIERVVDFRTQISGIR 131 >gb|ADN33800.1| RNA exonuclease [Cucumis melo subsp. melo] Length = 265 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 404 VNKWGNVIYDEYVRPVERVVDFRTQISGIR 493 VNKWGNVIYDE+VRP+ERVVDFRTQISGIR Sbjct: 104 VNKWGNVIYDEFVRPIERVVDFRTQISGIR 133 >ref|XP_003543225.1| PREDICTED: RNA exonuclease 4-like [Glycine max] Length = 266 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 404 VNKWGNVIYDEYVRPVERVVDFRTQISGIR 493 VNKWGNVIYDE+VRP+ERVVDFRT+ISGIR Sbjct: 98 VNKWGNVIYDEFVRPIERVVDFRTKISGIR 127 >ref|XP_003539610.1| PREDICTED: RNA exonuclease 4-like [Glycine max] Length = 266 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 404 VNKWGNVIYDEYVRPVERVVDFRTQISGIR 493 VNKWGNVIYDE+VRP+ERVVDFRT+ISGIR Sbjct: 98 VNKWGNVIYDEFVRPIERVVDFRTKISGIR 127 >gb|ACU17880.1| unknown [Glycine max] Length = 237 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 404 VNKWGNVIYDEYVRPVERVVDFRTQISGIR 493 VNKWGNVIYDE+VRP+ERVVDFRT+ISGIR Sbjct: 98 VNKWGNVIYDEFVRPIERVVDFRTKISGIR 127