BLASTX nr result
ID: Cephaelis21_contig00014856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014856 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84632.1| apocytochrome f precursor [Spinacia oleracea] 64 1e-08 ref|YP_538777.1| cytochrome f [Glycine max] gi|1345919|sp|P49161... 64 1e-08 ref|YP_006665793.1| cytochrome f (chloroplast) [Elodea canadensi... 64 1e-08 gb|AFB70599.1| cytochrome f, partial (chloroplast) [Portulaca ol... 64 1e-08 gb|AFB70597.1| cytochrome f, partial (chloroplast) [Portulacaria... 64 1e-08 >gb|AAA84632.1| apocytochrome f precursor [Spinacia oleracea] Length = 320 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 35 LRIEKGLLFFFASIILAQIFLVLKKKQFEKVQLVEMNF 148 LRI+ GLLFFFAS+ILAQIFLVLKKKQFEKVQL EMNF Sbjct: 284 LRIQ-GLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_538777.1| cytochrome f [Glycine max] gi|1345919|sp|P49161.1|CYF_SOYBN RecName: Full=Apocytochrome f; Flags: Precursor gi|984315|gb|AAA80649.1| cytochrome f precursor (chloroplast) [Glycine max] gi|83595756|gb|ABC25137.1| cytochrome f [Glycine max] Length = 320 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 35 LRIEKGLLFFFASIILAQIFLVLKKKQFEKVQLVEMNF 148 LR++ GLLFFFASIILAQIFLVLKKKQFEKVQL EMNF Sbjct: 284 LRVQ-GLLFFFASIILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_006665793.1| cytochrome f (chloroplast) [Elodea canadensis] gi|374094609|gb|AEY84665.1| cytochrome f (chloroplast) [Elodea canadensis] Length = 320 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 35 LRIEKGLLFFFASIILAQIFLVLKKKQFEKVQLVEMNF 148 LR++ GLLFFFAS+ILAQIFLVLKKKQFEKVQL EMNF Sbjct: 284 LRVQ-GLLFFFASVILAQIFLVLKKKQFEKVQLYEMNF 320 >gb|AFB70599.1| cytochrome f, partial (chloroplast) [Portulaca oleracea] Length = 320 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 35 LRIEKGLLFFFASIILAQIFLVLKKKQFEKVQLVEMNF 148 LR++ GLLFFFASIILAQIFLVLKKKQFEKVQL EMNF Sbjct: 284 LRVQ-GLLFFFASIILAQIFLVLKKKQFEKVQLSEMNF 320 >gb|AFB70597.1| cytochrome f, partial (chloroplast) [Portulacaria afra] Length = 320 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 35 LRIEKGLLFFFASIILAQIFLVLKKKQFEKVQLVEMNF 148 LR++ GLLFFFASIILAQIFLVLKKKQFEKVQL EMNF Sbjct: 284 LRVQ-GLLFFFASIILAQIFLVLKKKQFEKVQLSEMNF 320