BLASTX nr result
ID: Cephaelis21_contig00014786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014786 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321450.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 ref|XP_002318380.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 ref|XP_002297980.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 ref|XP_002304553.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 ref|XP_002509950.1| conserved hypothetical protein [Ricinus comm... 75 4e-12 >ref|XP_002321450.1| predicted protein [Populus trichocarpa] gi|222868446|gb|EEF05577.1| predicted protein [Populus trichocarpa] Length = 191 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/51 (64%), Positives = 43/51 (84%) Frame = +3 Query: 105 DFVSRNHMNGHHHLAGHQCSSSVVKHIKAPLDIVWSLVRKFDQPQKYKPFV 257 +++ R+H H LA HQCSS++VKHIKAP+ +VWSLVR+FDQPQKYKPF+ Sbjct: 17 EYIRRHHT--HDDLADHQCSSALVKHIKAPVQLVWSLVRRFDQPQKYKPFI 65 >ref|XP_002318380.1| predicted protein [Populus trichocarpa] gi|222859053|gb|EEE96600.1| predicted protein [Populus trichocarpa] Length = 191 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/51 (64%), Positives = 44/51 (86%) Frame = +3 Query: 105 DFVSRNHMNGHHHLAGHQCSSSVVKHIKAPLDIVWSLVRKFDQPQKYKPFV 257 +++ R+H +G LA HQCSS++VKHIKAP+ +VWSLVR+FDQPQKYKPF+ Sbjct: 17 EYIRRHHKHGD--LADHQCSSALVKHIKAPVHLVWSLVRRFDQPQKYKPFI 65 >ref|XP_002297980.1| predicted protein [Populus trichocarpa] gi|222845238|gb|EEE82785.1| predicted protein [Populus trichocarpa] Length = 190 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = +3 Query: 105 DFVSRNHMNGHHHLAGHQCSSSVVKHIKAPLDIVWSLVRKFDQPQKYKPFV 257 +F+ R+H H + HQCSSS+VKHIKAP+ +VWSLVR+FDQPQKYKPFV Sbjct: 17 EFIKRHHK---HDVKEHQCSSSLVKHIKAPVPLVWSLVRRFDQPQKYKPFV 64 >ref|XP_002304553.1| predicted protein [Populus trichocarpa] gi|222841985|gb|EEE79532.1| predicted protein [Populus trichocarpa] Length = 190 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = +3 Query: 105 DFVSRNHMNGHHHLAGHQCSSSVVKHIKAPLDIVWSLVRKFDQPQKYKPFV 257 +F+ R+H H + HQCSSS+VKHIKAP+ +VWSLVR+FDQPQKYKPFV Sbjct: 17 EFIKRHHK---HDVKEHQCSSSLVKHIKAPVPLVWSLVRRFDQPQKYKPFV 64 >ref|XP_002509950.1| conserved hypothetical protein [Ricinus communis] gi|223549849|gb|EEF51337.1| conserved hypothetical protein [Ricinus communis] Length = 196 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = +3 Query: 105 DFVSRNHMNGHHHLAGHQCSSSVVKHIKAPLDIVWSLVRKFDQPQKYKPFV 257 D++ R+H H + HQCSSS+VKHIKAP+ +VWSLVR+FDQPQ+YKPFV Sbjct: 23 DYIRRHHK---HDVKDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQRYKPFV 70