BLASTX nr result
ID: Cephaelis21_contig00014699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014699 (906 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542113.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_003546931.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 ref|XP_004152354.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_003632809.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_002517612.1| pentatricopeptide repeat-containing protein,... 61 4e-07 >ref|XP_003542113.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Glycine max] Length = 825 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = -2 Query: 905 ICSEGKSEEWRSIVSCDLNEHELSIAEKYSLIFDQYFRNGMVSKASEILHTLVKENSFRE 726 +C +GKS+EWR+I+SCDLN+ EL A KYSL D+Y G +S+AS IL TLV+++ F + Sbjct: 754 LCHKGKSKEWRNIISCDLNKIELQTAVKYSLTLDKYLYQGRLSEASVILQTLVEDSKFSD 813 >ref|XP_003546931.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Glycine max] Length = 808 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/59 (54%), Positives = 44/59 (74%) Frame = -2 Query: 905 ICSEGKSEEWRSIVSCDLNEHELSIAEKYSLIFDQYFRNGMVSKASEILHTLVKENSFR 729 +C +GKS+EWR+I+SCDLN+ EL A KYSL D+Y G +S+AS IL TL++E+ R Sbjct: 750 LCHKGKSKEWRNIISCDLNKIELQTAVKYSLTLDKYLYQGRLSEASVILQTLIEEDRVR 808 >ref|XP_004152354.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Cucumis sativus] gi|449484425|ref|XP_004156880.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Cucumis sativus] Length = 834 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -2 Query: 905 ICSEGKSEEWRSIVSCDLNEHELSIAEKYSLIFDQYFRNGMVSKASEILHTLVK 744 IC EG S+EWR+++SCDLNE EL IA KYSL D++ G +S+AS IL ++K Sbjct: 757 ICLEGNSKEWRNMISCDLNEGELQIALKYSLELDKFIPEGGISEASGILQAMIK 810 >ref|XP_003632809.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Vitis vinifera] Length = 879 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = -2 Query: 905 ICSEGKSEEWRSIVSCDLNEHELSIAEKYSLIFDQYFRNGMVSKASEILHTLVKE 741 +C EG+S+EW++IVSC+LNE EL IA YS I DQY G S+AS IL T+ +E Sbjct: 753 VCLEGRSKEWKNIVSCNLNERELQIAVNYSSILDQYLPQG-TSEASVILQTMFEE 806 >ref|XP_002517612.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543244|gb|EEF44776.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 794 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/59 (44%), Positives = 39/59 (66%) Frame = -2 Query: 905 ICSEGKSEEWRSIVSCDLNEHELSIAEKYSLIFDQYFRNGMVSKASEILHTLVKENSFR 729 +C EG+S++W +++SC LNE EL +A KYS D + G S+AS ILH+L + S + Sbjct: 719 LCLEGRSQDWNNVISCKLNERELQVAVKYSEKLDAFLSQGQTSEASLILHSLADQFSLQ 777