BLASTX nr result
ID: Cephaelis21_contig00014662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014662 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595526.1| Pentatricopeptide repeat-containing protein ... 57 2e-06 gb|AEC33263.1| putative pentatricopeptide protein [Triticum aest... 55 8e-06 >ref|XP_003595526.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355484574|gb|AES65777.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 229 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/79 (35%), Positives = 46/79 (58%) Frame = +2 Query: 95 HARLIKLGLHTNPLYASKLIAEYACLPAPNSLRHAHRVFDQVPSNLRDTALWASLISAYS 274 HA ++K GLH++ + L+ Y L L HA +FD + +++D W SLIS Y+ Sbjct: 73 HAHVLKSGLHSDRFVGNSLLTLYFKLNPGPHLSHARHLFDSL--HVKDVISWTSLISGYT 130 Query: 275 RSEQPNKALHLFSHLLCHP 331 RS+ P++++ LF +L P Sbjct: 131 RSDLPHQSISLFYEMLAFP 149 >gb|AEC33263.1| putative pentatricopeptide protein [Triticum aestivum] Length = 644 Score = 54.7 bits (130), Expect = 8e-06 Identities = 34/85 (40%), Positives = 45/85 (52%) Frame = +2 Query: 95 HARLIKLGLHTNPLYASKLIAEYACLPAPNSLRHAHRVFDQVPSNLRDTALWASLISAYS 274 HA + LGLH +P A +L+A YA AH VFD +PS R T W +LISAYS Sbjct: 95 HAHALHLGLHAHPDVAGQLLAAYA---RHGRADEAHHVFDAMPSK-RATMSWNTLISAYS 150 Query: 275 RSEQPNKALHLFSHLLCHPQASQNA 349 PN A+ F+ + +A +A Sbjct: 151 VCCDPNNAMATFARMAAAGEALPDA 175