BLASTX nr result
ID: Cephaelis21_contig00014587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014587 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306555.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002302327.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002514002.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|NP_567434.1| protein transport protein SFT1 [Arabidopsis tha... 57 2e-06 ref|XP_002870304.1| hypothetical protein ARALYDRAFT_355343 [Arab... 57 2e-06 >ref|XP_002306555.1| predicted protein [Populus trichocarpa] gi|222856004|gb|EEE93551.1| predicted protein [Populus trichocarpa] Length = 135 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +1 Query: 40 KEREGLSTRQTGTSDEI*LRIDPIHGKLDEEITGLRKQVCQLRNAS 177 + REGLSTR +SDEI LRIDPIHG LD+EITGLR QV QLRN + Sbjct: 20 RSREGLSTRPMASSDEIQLRIDPIHGDLDDEITGLRSQVRQLRNVA 65 >ref|XP_002302327.1| predicted protein [Populus trichocarpa] gi|222844053|gb|EEE81600.1| predicted protein [Populus trichocarpa] Length = 122 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +1 Query: 40 KEREGLSTRQTGTSDEI*LRIDPIHGKLDEEITGLRKQVCQLRNAS 177 + REGLSTR +SDEI LRIDPIH LD+EITGLR QV QLRN + Sbjct: 7 RSREGLSTRPVASSDEIQLRIDPIHWDLDDEITGLRSQVRQLRNVA 52 >ref|XP_002514002.1| conserved hypothetical protein [Ricinus communis] gi|223547088|gb|EEF48585.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +1 Query: 40 KEREGLSTRQTGTSDEI*LRIDPIHGKLDEEITGLRKQVCQLRNAS 177 + REGL+TR G+SDEI LRIDP+H D+EI+GLR QV LRN + Sbjct: 19 RSREGLTTRPVGSSDEIQLRIDPMHADFDDEISGLRGQVKLLRNVA 64 >ref|NP_567434.1| protein transport protein SFT1 [Arabidopsis thaliana] gi|75248462|sp|Q8VXX9.1|BETL1_ARATH RecName: Full=Bet1-like protein At4g14600 gi|18389246|gb|AAL67066.1| unknown protein [Arabidopsis thaliana] gi|20259643|gb|AAM14339.1| unknown protein [Arabidopsis thaliana] gi|21554084|gb|AAM63165.1| unknown [Arabidopsis thaliana] gi|26452326|dbj|BAC43249.1| unknown protein [Arabidopsis thaliana] gi|332658064|gb|AEE83464.1| protein transport protein SFT1 [Arabidopsis thaliana] Length = 137 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 40 KEREGLSTRQTGTSDEI*LRIDPIHGKLDEEITGLRKQVCQLRN 171 + REGLSTR S+EI LRIDP+H LD+EITGL QV QL+N Sbjct: 22 RSREGLSTRNAAGSEEIQLRIDPMHSDLDDEITGLHGQVRQLKN 65 >ref|XP_002870304.1| hypothetical protein ARALYDRAFT_355343 [Arabidopsis lyrata subsp. lyrata] gi|297316140|gb|EFH46563.1| hypothetical protein ARALYDRAFT_355343 [Arabidopsis lyrata subsp. lyrata] Length = 726 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 40 KEREGLSTRQTGTSDEI*LRIDPIHGKLDEEITGLRKQVCQLRN 171 + REGLSTR S+EI LRIDP+H LD+EITGL QV QL+N Sbjct: 611 RSREGLSTRNAAGSEEIQLRIDPMHSDLDDEITGLHGQVRQLKN 654