BLASTX nr result
ID: Cephaelis21_contig00014543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014543 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528094.1| translation initiation factor if-2, putative... 58 7e-07 ref|XP_002893155.1| hypothetical protein ARALYDRAFT_313019 [Arab... 57 2e-06 ref|XP_002889103.1| hypothetical protein ARALYDRAFT_476840 [Arab... 57 2e-06 gb|AAN32916.1| translation initiation factor [Pisum sativum] 57 2e-06 ref|XP_003556148.1| PREDICTED: uncharacterized protein LOC100814... 57 2e-06 >ref|XP_002528094.1| translation initiation factor if-2, putative [Ricinus communis] gi|223532483|gb|EEF34273.1| translation initiation factor if-2, putative [Ricinus communis] Length = 1263 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 117 NSGEGVPDLLLLLVQWARKTMIEKLTYQNEVQ 212 N GEG+PDLLLLLVQW +KTM+EKLTY +EVQ Sbjct: 866 NGGEGIPDLLLLLVQWTQKTMVEKLTYSDEVQ 897 >ref|XP_002893155.1| hypothetical protein ARALYDRAFT_313019 [Arabidopsis lyrata subsp. lyrata] gi|297338997|gb|EFH69414.1| hypothetical protein ARALYDRAFT_313019 [Arabidopsis lyrata subsp. lyrata] Length = 1429 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 120 SGEGVPDLLLLLVQWARKTMIEKLTYQNEVQ 212 SGEGVPDLLLLLVQWA+KTM+EKLTY ++VQ Sbjct: 575 SGEGVPDLLLLLVQWAQKTMVEKLTYVDKVQ 605 >ref|XP_002889103.1| hypothetical protein ARALYDRAFT_476840 [Arabidopsis lyrata subsp. lyrata] gi|297334944|gb|EFH65362.1| hypothetical protein ARALYDRAFT_476840 [Arabidopsis lyrata subsp. lyrata] Length = 1257 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 120 SGEGVPDLLLLLVQWARKTMIEKLTYQNEVQ 212 SGEGVPDLLLLLVQWA+K+M+EKLTY +EVQ Sbjct: 846 SGEGVPDLLLLLVQWAQKSMVEKLTYVDEVQ 876 >gb|AAN32916.1| translation initiation factor [Pisum sativum] Length = 861 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 120 SGEGVPDLLLLLVQWARKTMIEKLTYQNEVQ 212 SGEG+PD+LLLLVQW +KTMIEKLTY +EVQ Sbjct: 465 SGEGIPDMLLLLVQWTQKTMIEKLTYSDEVQ 495 >ref|XP_003556148.1| PREDICTED: uncharacterized protein LOC100814875 [Glycine max] Length = 1355 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 120 SGEGVPDLLLLLVQWARKTMIEKLTYQNEVQ 212 SGEG+PDLLLLL+QW +KTM+EKLTY EVQ Sbjct: 959 SGEGIPDLLLLLIQWTQKTMVEKLTYSEEVQ 989