BLASTX nr result
ID: Cephaelis21_contig00014515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014515 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528757.1| conserved hypothetical protein [Ricinus comm... 65 8e-09 emb|CAB85508.1| putative protein [Arabidopsis thaliana] gi|97580... 64 2e-08 ref|XP_002873122.1| hypothetical protein ARALYDRAFT_487166 [Arab... 64 2e-08 ref|NP_568128.1| thioredoxin family protein [Arabidopsis thalian... 64 2e-08 gb|AAM65224.1| unknown [Arabidopsis thaliana] 64 2e-08 >ref|XP_002528757.1| conserved hypothetical protein [Ricinus communis] gi|223531851|gb|EEF33669.1| conserved hypothetical protein [Ricinus communis] Length = 344 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 417 VNSLSLHCSCARGSPKRQILYDKAGHFQVPYLEDPNTG 530 + L + CARGSPKRQ LY+KAGHFQVPYLEDPNTG Sbjct: 287 IXXLRMRSFCARGSPKRQTLYEKAGHFQVPYLEDPNTG 324 >emb|CAB85508.1| putative protein [Arabidopsis thaliana] gi|9758017|dbj|BAB08614.1| unnamed protein product [Arabidopsis thaliana] Length = 331 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 441 SCARGSPKRQILYDKAGHFQVPYLEDPNTG 530 SCARGSPKRQ+L +KAGHFQVPYLEDPNTG Sbjct: 283 SCARGSPKRQVLLEKAGHFQVPYLEDPNTG 312 >ref|XP_002873122.1| hypothetical protein ARALYDRAFT_487166 [Arabidopsis lyrata subsp. lyrata] gi|297318959|gb|EFH49381.1| hypothetical protein ARALYDRAFT_487166 [Arabidopsis lyrata subsp. lyrata] Length = 336 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 441 SCARGSPKRQILYDKAGHFQVPYLEDPNTG 530 SCARGSPKRQ+L +KAGHFQVPYLEDPNTG Sbjct: 288 SCARGSPKRQVLLEKAGHFQVPYLEDPNTG 317 >ref|NP_568128.1| thioredoxin family protein [Arabidopsis thaliana] gi|15451054|gb|AAK96798.1| Unknown protein [Arabidopsis thaliana] gi|20148315|gb|AAM10048.1| unknown protein [Arabidopsis thaliana] gi|332003283|gb|AED90666.1| thioredoxin family protein [Arabidopsis thaliana] Length = 339 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 441 SCARGSPKRQILYDKAGHFQVPYLEDPNTG 530 SCARGSPKRQ+L +KAGHFQVPYLEDPNTG Sbjct: 291 SCARGSPKRQVLLEKAGHFQVPYLEDPNTG 320 >gb|AAM65224.1| unknown [Arabidopsis thaliana] Length = 339 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 441 SCARGSPKRQILYDKAGHFQVPYLEDPNTG 530 SCARGSPKRQ+L +KAGHFQVPYLEDPNTG Sbjct: 291 SCARGSPKRQVLLEKAGHFQVPYLEDPNTG 320