BLASTX nr result
ID: Cephaelis21_contig00014514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014514 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540148.1| PREDICTED: tRNA pseudouridine synthase A-lik... 61 8e-08 ref|XP_003592926.1| tRNA pseudouridine synthase A [Medicago trun... 60 2e-07 ref|NP_001242177.1| uncharacterized protein LOC100799818 [Glycin... 60 2e-07 gb|ABE79574.2| tRNA pseudouridine synthase [Medicago truncatula] 60 2e-07 ref|XP_002263416.1| PREDICTED: tRNA pseudouridine synthase A [Vi... 60 2e-07 >ref|XP_003540148.1| PREDICTED: tRNA pseudouridine synthase A-like [Glycine max] Length = 369 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 1 VELILNAKTVAAASPMAPACGLYLGHVKYDLP 96 VE ILNAKTV AASPMAPACGLYLG VKYDLP Sbjct: 336 VERILNAKTVTAASPMAPACGLYLGEVKYDLP 367 >ref|XP_003592926.1| tRNA pseudouridine synthase A [Medicago truncatula] gi|355481974|gb|AES63177.1| tRNA pseudouridine synthase A [Medicago truncatula] Length = 375 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 VELILNAKTVAAASPMAPACGLYLGHVKYDLPA 99 VE ILNAKTV A SPMAPACGLYLG VKYDLP+ Sbjct: 343 VERILNAKTVTATSPMAPACGLYLGEVKYDLPS 375 >ref|NP_001242177.1| uncharacterized protein LOC100799818 [Glycine max] gi|255637177|gb|ACU18919.1| unknown [Glycine max] Length = 370 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 1 VELILNAKTVAAASPMAPACGLYLGHVKYDLP 96 VE ILNA+TV AASPMAPACGLYLG VKYDLP Sbjct: 337 VERILNARTVTAASPMAPACGLYLGEVKYDLP 368 >gb|ABE79574.2| tRNA pseudouridine synthase [Medicago truncatula] Length = 361 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 VELILNAKTVAAASPMAPACGLYLGHVKYDLPA 99 VE ILNAKTV A SPMAPACGLYLG VKYDLP+ Sbjct: 329 VERILNAKTVTATSPMAPACGLYLGEVKYDLPS 361 >ref|XP_002263416.1| PREDICTED: tRNA pseudouridine synthase A [Vitis vinifera] gi|297739525|emb|CBI29707.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 1 VELILNAKTVAAASPMAPACGLYLGHVKYDLP 96 VE ILNAKTV AASPMAPACGLYLG+V YDLP Sbjct: 349 VERILNAKTVTAASPMAPACGLYLGNVNYDLP 380