BLASTX nr result
ID: Cephaelis21_contig00013289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00013289 (669 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135517.1| PREDICTED: serine/threonine-protein kinase B... 60 3e-07 >ref|XP_004135517.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Cucumis sativus] gi|449521852|ref|XP_004167943.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Cucumis sativus] Length = 343 Score = 60.5 bits (145), Expect = 3e-07 Identities = 42/125 (33%), Positives = 66/125 (52%), Gaps = 12/125 (9%) Frame = -3 Query: 583 FYCSARGYS---LMHDVFSFGVILLSLIAKRVFDIS---------WPRTSLATWAKKDGK 440 F+ S RG S + DV+S G ILL LIAKR + + +S++ WAK + + Sbjct: 207 FHPSIRGESEGKVNSDVYSLGEILLGLIAKRDVEPQNLEKQNHQEFVNSSVSIWAKNEYR 266 Query: 439 DKVSWSALERNVFSEHEIFKEDPDYDAYDGQKLMKLAMSCIELLPKDRPTMQEICESMQA 260 VS HE ++D Y +G KL +LAM IE P++RP++++I + ++A Sbjct: 267 PNVSLV---------HESLQKDWGYSTEEGIKLTELAMHSIEFFPRNRPSIKQILQHLEA 317 Query: 259 LHVVQ 245 L V + Sbjct: 318 LQVTR 322