BLASTX nr result
ID: Cephaelis21_contig00013132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00013132 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24890.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_003563009.1| PREDICTED: 60S ribosomal protein L36a-like i... 57 2e-06 emb|CBI27147.3| unnamed protein product [Vitis vinifera] 57 2e-06 gb|EKV05032.1| hypothetical protein PDIP_85240 [Penicillium digi... 56 3e-06 gb|AAK94425.1|AF398144_1 60S ribosomal protein L144 [Brassica ra... 56 3e-06 >emb|CBI24890.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +1 Query: 115 VDLSLDSFPPSA-KMVNVPKTKKTYCKSKDCRKHTLHK 225 + LS PP KMVNVPKTKKTYCKSK+CRKHTLHK Sbjct: 22 LQLSFSLHPPKPPKMVNVPKTKKTYCKSKECRKHTLHK 59 >ref|XP_003563009.1| PREDICTED: 60S ribosomal protein L36a-like isoform 2 [Brachypodium distachyon] Length = 133 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +1 Query: 94 SILQKFSVDLSLDSFPPSAKMVNVPKTKKTYCKSKDCRKHTLHK 225 S+ +S D ++ FP VNVPKTKKTYCK+K+C+KHTLHK Sbjct: 9 SLRPDYSNDATISIFPEVPIGVNVPKTKKTYCKNKECKKHTLHK 52 >emb|CBI27147.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 145 SAKMVNVPKTKKTYCKSKDCRKHTLHK 225 S MVNVPKTKKTYCKSK+CRKHTLHK Sbjct: 207 SVTMVNVPKTKKTYCKSKECRKHTLHK 233 >gb|EKV05032.1| hypothetical protein PDIP_85240 [Penicillium digitatum Pd1] gi|425775196|gb|EKV13478.1| hypothetical protein PDIG_38600 [Penicillium digitatum PHI26] Length = 455 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 3/65 (4%) Frame = +1 Query: 40 ISNFPICVARFSSVG--VIYSILQKFSVDLSLDSFPP-SAKMVNVPKTKKTYCKSKDCRK 210 +S +PI R S + ++L++ ++ S+P S KMVN+PKT++TYCKSK+C K Sbjct: 309 VSAYPIGPKRVKSHNPTIALALLRQATIQRPPPSYPAKSVKMVNIPKTRRTYCKSKECHK 368 Query: 211 HTLHK 225 HT HK Sbjct: 369 HTQHK 373 >gb|AAK94425.1|AF398144_1 60S ribosomal protein L144 [Brassica rapa subsp. pekinensis] Length = 119 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = +1 Query: 148 AKMVNVPKTKKTYCKSKDCRKHTLHK 225 AKMVN+PKTKKTYCK+K+C+KHTLHK Sbjct: 13 AKMVNIPKTKKTYCKNKECKKHTLHK 38