BLASTX nr result
ID: Cephaelis21_contig00013038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00013038 (477 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFZ78580.1| cellulose synthase-like protein [Populus tomentosa] 64 2e-08 ref|XP_002320471.1| hypothetical protein POPTRDRAFT_246659 [Popu... 64 2e-08 ref|XP_003539497.1| PREDICTED: cellulose synthase-like protein H... 61 8e-08 ref|XP_003596946.1| Cellulose synthase-like protein H1 [Medicago... 59 3e-07 ref|XP_002302868.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 >gb|AFZ78580.1| cellulose synthase-like protein [Populus tomentosa] Length = 746 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +2 Query: 332 GPGLGEFVYSI*AVLCFWAFLKEPFGKGKYGIPFSTIYKSVWLGLLFL 475 G GLGE + SI V+CFW FLK F KGKYGIP STI+KS +L L F+ Sbjct: 693 GSGLGERLCSIMVVICFWPFLKGLFAKGKYGIPLSTIFKSAFLALCFV 740 >ref|XP_002320471.1| hypothetical protein POPTRDRAFT_246659 [Populus trichocarpa] gi|222861244|gb|EEE98786.1| hypothetical protein POPTRDRAFT_246659 [Populus trichocarpa] Length = 746 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +2 Query: 332 GPGLGEFVYSI*AVLCFWAFLKEPFGKGKYGIPFSTIYKSVWLGLLFL 475 G GLGE + SI V+CFW FLK F KGKYGIP STI+KS +L L F+ Sbjct: 693 GSGLGERLCSIMVVICFWPFLKGLFAKGKYGIPLSTIFKSAFLALCFV 740 >ref|XP_003539497.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max] Length = 748 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = +2 Query: 332 GPGLGEFVYSI*AVLCFWAFLKEPFGKGKYGIPFSTIYKSVWLGLLFL 475 G GLGEF+ S V+C+W + K FG+GKYGIPFST+ KSV L+F+ Sbjct: 691 GSGLGEFICSTYLVMCYWPYFKGLFGRGKYGIPFSTMCKSVVFALVFV 738 >ref|XP_003596946.1| Cellulose synthase-like protein H1 [Medicago truncatula] gi|355485994|gb|AES67197.1| Cellulose synthase-like protein H1 [Medicago truncatula] Length = 795 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = +2 Query: 314 LVQGRKGPGLGEFVYSI*AVLCFWAFLKEPFGKGKYGIPFSTIYKSVWLGLLFL 475 +V G GLGE + S+ V+C+W FLK F +GKYGIP STI+KS L +F+ Sbjct: 708 VVHSGNGCGLGELMCSVYLVVCYWPFLKGLFARGKYGIPLSTIFKSALLTFIFV 761 >ref|XP_002302868.1| predicted protein [Populus trichocarpa] gi|222844594|gb|EEE82141.1| predicted protein [Populus trichocarpa] Length = 749 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +2 Query: 338 GLGEFVYSI*AVLCFWAFLKEPFGKGKYGIPFSTIYKSVWLGLLFL 475 GLGE + S+ V+CFW F+K FGKGKYGIP STI KS L L F+ Sbjct: 693 GLGEILCSVLVVMCFWPFVKGLFGKGKYGIPLSTICKSSLLSLSFV 738