BLASTX nr result
ID: Cephaelis21_contig00012893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00012893 (514 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20261.3| unnamed protein product [Vitis vinifera] 78 9e-13 ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat... 78 9e-13 emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] 77 1e-12 ref|XP_002532249.1| pentatricopeptide repeat-containing protein,... 66 3e-09 ref|XP_002279088.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 >emb|CBI20261.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = -1 Query: 196 TFSEDLVLNVLKRLSSDWKPAYKFFKWVCEAKFPDGYSPGTGVYNAMLDILGRMHQFDKL 17 + ++DLVL+VLKR SDW+PAY FF W GYSPG GV+N +LDILGRM +F ++ Sbjct: 115 SLTDDLVLDVLKRHRSDWRPAYVFFNWASRCGIESGYSPGCGVHNEILDILGRMRRFHEM 174 Query: 16 CHLLE 2 L + Sbjct: 175 TQLFD 179 >ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Vitis vinifera] Length = 546 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = -1 Query: 196 TFSEDLVLNVLKRLSSDWKPAYKFFKWVCEAKFPDGYSPGTGVYNAMLDILGRMHQFDKL 17 + ++DLVL+VLKR SDW+PAY FF W GYSPG GV+N +LDILGRM +F ++ Sbjct: 115 SLTDDLVLDVLKRHRSDWRPAYVFFNWASRCGIESGYSPGCGVHNEILDILGRMRRFHEM 174 Query: 16 CHLLE 2 L + Sbjct: 175 TQLFD 179 >emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] Length = 546 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = -1 Query: 196 TFSEDLVLNVLKRLSSDWKPAYKFFKWVCEAKFPDGYSPGTGVYNAMLDILGRMHQFDKL 17 + ++DLVL+VLKR SDW+PAY FF W GYSPG GV+N +LDILGRM +F ++ Sbjct: 115 SLTDDLVLDVLKRHRSDWRPAYVFFNWASRCGXESGYSPGCGVHNEILDILGRMRRFHEM 174 Query: 16 CHLLE 2 L + Sbjct: 175 TQLFD 179 >ref|XP_002532249.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528067|gb|EEF30143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/65 (50%), Positives = 43/65 (66%) Frame = -1 Query: 196 TFSEDLVLNVLKRLSSDWKPAYKFFKWVCEAKFPDGYSPGTGVYNAMLDILGRMHQFDKL 17 T +EDL+L VLKR SDWKPA FF WV + G+G YN +LDILG+M +FD+L Sbjct: 77 TVTEDLILKVLKRHRSDWKPALIFFNWVSKG---GKVLMGSGAYNEILDILGKMRRFDEL 133 Query: 16 CHLLE 2 +L+ Sbjct: 134 SQVLD 138 >ref|XP_002279088.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Vitis vinifera] Length = 535 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/63 (50%), Positives = 41/63 (65%) Frame = -1 Query: 190 SEDLVLNVLKRLSSDWKPAYKFFKWVCEAKFPDGYSPGTGVYNAMLDILGRMHQFDKLCH 11 SE LV VLKR S+DW PA+ FFKW AK GY YN+M+DILG++ +FD + Sbjct: 118 SESLVEQVLKRFSNDWIPAFGFFKW---AKAQTGYRHSMNSYNSMVDILGKLKKFDLMWE 174 Query: 10 LLE 2 L+E Sbjct: 175 LVE 177