BLASTX nr result
ID: Cephaelis21_contig00012768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00012768 (719 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166152.1| PREDICTED: 60S ribosomal protein L35-2-like,... 74 4e-11 ref|XP_003537214.1| PREDICTED: 60S ribosomal protein L35-like [G... 74 4e-11 ref|NP_001237725.1| uncharacterized protein LOC100306624 [Glycin... 74 4e-11 gb|AEC10955.1| ribosomal protein L35 [Camellia sinensis] 73 7e-11 gb|ABK22760.1| unknown [Picea sitchensis] gi|116783867|gb|ABK231... 73 7e-11 >ref|XP_004166152.1| PREDICTED: 60S ribosomal protein L35-2-like, partial [Cucumis sativus] Length = 78 Score = 73.6 bits (179), Expect = 4e-11 Identities = 39/54 (72%), Positives = 41/54 (75%) Frame = -3 Query: 636 CRKVACFSITQVLMVISQK*NSTLREAYKKMKYLPLDV*PKKTRAIYRRLTKHQ 475 C KV SI QVL VISQK + LREAYKK K LPLD+ PKKTRAI RRLTKHQ Sbjct: 1 CSKVVRLSIAQVLTVISQKQKAALREAYKKKKLLPLDLRPKKTRAIRRRLTKHQ 54 >ref|XP_003537214.1| PREDICTED: 60S ribosomal protein L35-like [Glycine max] gi|356550243|ref|XP_003543497.1| PREDICTED: 60S ribosomal protein L35-like [Glycine max] Length = 123 Score = 73.6 bits (179), Expect = 4e-11 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -3 Query: 630 KVACFSITQVLMVISQK*NSTLREAYKKMKYLPLDV*PKKTRAIYRRLTKHQ 475 KV SI QVL VISQK + LREAYKK KYLPLD+ PKKTRAI RRLTKHQ Sbjct: 48 KVVRLSIAQVLTVISQKQKAALREAYKKKKYLPLDLRPKKTRAIRRRLTKHQ 99 >ref|NP_001237725.1| uncharacterized protein LOC100306624 [Glycine max] gi|255629113|gb|ACU14901.1| unknown [Glycine max] Length = 123 Score = 73.6 bits (179), Expect = 4e-11 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -3 Query: 630 KVACFSITQVLMVISQK*NSTLREAYKKMKYLPLDV*PKKTRAIYRRLTKHQ 475 KV SI QVL VISQK + LREAYKK KYLPLD+ PKKTRAI RRLTKHQ Sbjct: 48 KVVRLSIAQVLTVISQKQKAALREAYKKKKYLPLDLRPKKTRAIRRRLTKHQ 99 >gb|AEC10955.1| ribosomal protein L35 [Camellia sinensis] Length = 123 Score = 72.8 bits (177), Expect = 7e-11 Identities = 39/52 (75%), Positives = 40/52 (76%) Frame = -3 Query: 630 KVACFSITQVLMVISQK*NSTLREAYKKMKYLPLDV*PKKTRAIYRRLTKHQ 475 KV SI QVL VISQK S LREAYK KYLPLD+ PKKTRAI RRLTKHQ Sbjct: 48 KVVRLSIAQVLTVISQKQKSVLREAYKNKKYLPLDLRPKKTRAIRRRLTKHQ 99 >gb|ABK22760.1| unknown [Picea sitchensis] gi|116783867|gb|ABK23118.1| unknown [Picea sitchensis] gi|116789576|gb|ABK25299.1| unknown [Picea sitchensis] gi|116790045|gb|ABK25481.1| unknown [Picea sitchensis] gi|148905932|gb|ABR16127.1| unknown [Picea sitchensis] gi|148906701|gb|ABR16499.1| unknown [Picea sitchensis] gi|224286658|gb|ACN41033.1| unknown [Picea sitchensis] Length = 123 Score = 72.8 bits (177), Expect = 7e-11 Identities = 39/52 (75%), Positives = 40/52 (76%) Frame = -3 Query: 630 KVACFSITQVLMVISQK*NSTLREAYKKMKYLPLDV*PKKTRAIYRRLTKHQ 475 KV SI QVL VISQ S LREAYKK KYLPLD+ PKKTRAI RRLTKHQ Sbjct: 48 KVVRLSIAQVLTVISQNQRSALREAYKKKKYLPLDLRPKKTRAIRRRLTKHQ 99