BLASTX nr result
ID: Cephaelis21_contig00011669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011669 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271972.2| PREDICTED: uncharacterized protein LOC100261... 69 3e-10 emb|CBI29042.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_003636724.1| Lysine-specific demethylase 3B [Medicago tru... 68 7e-10 ref|XP_003592698.1| Lysine-specific demethylase 3A [Medicago tru... 68 7e-10 ref|XP_002520404.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 >ref|XP_002271972.2| PREDICTED: uncharacterized protein LOC100261347 [Vitis vinifera] Length = 1199 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +3 Query: 174 VRDVLKTTSVLSWEPMVMWRAFLQKRSVKHPLVLDVTAINCLDWCE 311 VRDVL+ TS LSWEPMVMWRAF Q + H L+VTA++CLDWCE Sbjct: 830 VRDVLENTSGLSWEPMVMWRAFRQITNTNHAQHLEVTAMDCLDWCE 875 >emb|CBI29042.3| unnamed protein product [Vitis vinifera] Length = 1019 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +3 Query: 174 VRDVLKTTSVLSWEPMVMWRAFLQKRSVKHPLVLDVTAINCLDWCE 311 VRDVL+ TS LSWEPMVMWRAF Q + H L+VTA++CLDWCE Sbjct: 646 VRDVLENTSGLSWEPMVMWRAFRQITNTNHAQHLEVTAMDCLDWCE 691 >ref|XP_003636724.1| Lysine-specific demethylase 3B [Medicago truncatula] gi|355502659|gb|AES83862.1| Lysine-specific demethylase 3B [Medicago truncatula] Length = 989 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +3 Query: 174 VRDVLKTTSVLSWEPMVMWRAFLQKRSVKHPLVLDVTAINCLDWCE 311 V +VL+ TS LSWEP+VMWRAF Q + K+ +VLDV A+NCLDWCE Sbjct: 557 VSNVLECTSGLSWEPLVMWRAFRQITNSKYDVVLDVKAVNCLDWCE 602 >ref|XP_003592698.1| Lysine-specific demethylase 3A [Medicago truncatula] gi|355481746|gb|AES62949.1| Lysine-specific demethylase 3A [Medicago truncatula] Length = 895 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +3 Query: 174 VRDVLKTTSVLSWEPMVMWRAFLQKRSVKHPLVLDVTAINCLDWCE 311 V +VL+ TS LSWEP+VMWRAF Q + K+ +VLDV A+NCLDWCE Sbjct: 557 VSNVLECTSGLSWEPLVMWRAFRQITNSKYDVVLDVKAVNCLDWCE 602 >ref|XP_002520404.1| conserved hypothetical protein [Ricinus communis] gi|223540389|gb|EEF41959.1| conserved hypothetical protein [Ricinus communis] Length = 1099 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +3 Query: 174 VRDVLKTTSVLSWEPMVMWRAFLQKRSVKHPLVLDVTAINCLDWCE 311 V +VL+T + LSWEPMVMWRAF Q ++ KH +LDV AI CLDWCE Sbjct: 658 VSNVLETATGLSWEPMVMWRAFRQIKNEKHDTLLDVKAIECLDWCE 703