BLASTX nr result
ID: Cephaelis21_contig00011650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011650 (1814 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520226.1| conserved hypothetical protein [Ricinus comm... 78 9e-12 >ref|XP_002520226.1| conserved hypothetical protein [Ricinus communis] gi|223540594|gb|EEF42159.1| conserved hypothetical protein [Ricinus communis] Length = 184 Score = 77.8 bits (190), Expect = 9e-12 Identities = 52/138 (37%), Positives = 72/138 (52%), Gaps = 1/138 (0%) Frame = -1 Query: 1145 THVNQTFSIKINSKNYIS*KLQFTSLLNFIIYMEFFTTPNLQPQRNS*S-FDKTMWNPTL 969 T++ Q+FSIK+ SKNYI KLQFT L N ++ T P+ S ++++ NP Sbjct: 31 TNIQQSFSIKLTSKNYIPWKLQFTPLFNLYLHGIANGTEVAPPREIIDSNVNQSILNPEY 90 Query: 968 LIWFDFSNIKFSSLGCCPLLLRKFIHT*LVSQHPPKFDMH*LVAAYGVVCHAQRTQLHIE 789 WF + FS + L +AYGVV HAQRTQLHIE Sbjct: 91 TAWFAKDQLLFSEVWRA------------------------LASAYGVVSHAQRTQLHIE 126 Query: 788 LHDISKDDK*VSEHLAKA 735 L ++SKD+K VS++L +A Sbjct: 127 LQNLSKDEKPVSQYLYQA 144