BLASTX nr result
ID: Cephaelis21_contig00010429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00010429 (853 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267457.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 86 1e-14 ref|XP_002304436.1| predicted protein [Populus trichocarpa] gi|2... 84 5e-14 ref|XP_002509609.1| conserved hypothetical protein [Ricinus comm... 82 2e-13 ref|XP_002329853.1| predicted protein [Populus trichocarpa] gi|2... 82 2e-13 ref|XP_002509613.1| immature colon carcinoma transcript, putativ... 82 2e-13 >ref|XP_002267457.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial [Vitis vinifera] gi|296082846|emb|CBI22147.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = +3 Query: 3 AIIDAACYVPPPPSEETIKKITKLSAIEEEKRLNKKKALSQKKAFRRSRESWD 161 AIIDAA YVPPPPSEE KKI KL+AI E+KRL KK LSQKKAFRRSR+SWD Sbjct: 178 AIIDAASYVPPPPSEEQKKKIAKLAAIGEQKRLQNKKVLSQKKAFRRSRDSWD 230 >ref|XP_002304436.1| predicted protein [Populus trichocarpa] gi|222841868|gb|EEE79415.1| predicted protein [Populus trichocarpa] Length = 229 Score = 83.6 bits (205), Expect = 5e-14 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = +3 Query: 3 AIIDAACYVPPPPSEETIKKITKLSAIEEEKRLNKKKALSQKKAFRRSRESWD 161 AIID A YVPPPPSEE KKI KL+AI E+KRL KKALS KKAFRRSR+SWD Sbjct: 177 AIIDVASYVPPPPSEEQKKKIAKLAAIGEQKRLKSKKALSDKKAFRRSRDSWD 229 >ref|XP_002509609.1| conserved hypothetical protein [Ricinus communis] gi|223549508|gb|EEF50996.1| conserved hypothetical protein [Ricinus communis] Length = 79 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +3 Query: 3 AIIDAACYVPPPPSEETIKKITKLSAIEEEKRLNKKKALSQKKAFRRSRESWD 161 AIIDAA YVPPPPSEE KKI KL+A+ E+KRL KK LS KKAFRRSR SWD Sbjct: 27 AIIDAASYVPPPPSEEQKKKIAKLAALGEQKRLKSKKVLSDKKAFRRSRNSWD 79 >ref|XP_002329853.1| predicted protein [Populus trichocarpa] gi|222871090|gb|EEF08221.1| predicted protein [Populus trichocarpa] Length = 226 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = +3 Query: 3 AIIDAACYVPPPPSEETIKKITKLSAIEEEKRLNKKKALSQKKAFRRSRESWD 161 A+IDAA YVPPPPSEE KKI KL++I E+KRL KK LS KKAFRRSR+SWD Sbjct: 174 AVIDAASYVPPPPSEEQKKKIAKLASIGEQKRLRSKKVLSDKKAFRRSRDSWD 226 >ref|XP_002509613.1| immature colon carcinoma transcript, putative [Ricinus communis] gi|223549512|gb|EEF51000.1| immature colon carcinoma transcript, putative [Ricinus communis] Length = 234 Score = 81.6 bits (200), Expect = 2e-13 Identities = 41/53 (77%), Positives = 43/53 (81%) Frame = +3 Query: 3 AIIDAACYVPPPPSEETIKKITKLSAIEEEKRLNKKKALSQKKAFRRSRESWD 161 AIIDAA YVPPPPSEE KKI KL+AI E+KRL KK LS KKAFRRSR SWD Sbjct: 182 AIIDAASYVPPPPSEEQKKKIAKLAAIGEQKRLKSKKVLSDKKAFRRSRISWD 234