BLASTX nr result
ID: Cephaelis21_contig00010300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00010300 (704 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, p... 134 1e-29 sp|Q06450.2|ATP5E_IPOBA RecName: Full=ATP synthase subunit epsil... 130 2e-28 gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] 130 3e-28 ref|XP_004141742.1| PREDICTED: ATP synthase subunit epsilon, mit... 129 7e-28 ref|NP_175576.1| ATP synthase subunit epsilon [Arabidopsis thali... 129 7e-28 >ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] gi|223543599|gb|EEF45128.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] Length = 70 Score = 134 bits (338), Expect = 1e-29 Identities = 60/69 (86%), Positives = 66/69 (95%) Frame = -2 Query: 547 MASNAAVPFWRAAGMTYITYSNLCANLVRNCLKEPHRSEALNREKVHFAATKWVDGKPLK 368 MASNAAVPFWRAAGMTYITYSN+CANLVRNCLKEPH++EAL REKVHF+ +KWVDGKP K Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCLKEPHKTEALTREKVHFSVSKWVDGKPQK 60 Query: 367 PTIRSDTPE 341 PT+RSDTPE Sbjct: 61 PTMRSDTPE 69 >sp|Q06450.2|ATP5E_IPOBA RecName: Full=ATP synthase subunit epsilon, mitochondrial; Short=ATPase subunit epsilon gi|303625|dbj|BAA03527.1| F1-ATPase epsilon-subunit [Ipomoea batatas] Length = 70 Score = 130 bits (328), Expect = 2e-28 Identities = 60/70 (85%), Positives = 66/70 (94%) Frame = -2 Query: 547 MASNAAVPFWRAAGMTYITYSNLCANLVRNCLKEPHRSEALNREKVHFAATKWVDGKPLK 368 MASNAAVPFWRAAGMTYITYSNLCAN+VRNCLKEP+R+EAL+REKVHF+ +KWVDGKP K Sbjct: 1 MASNAAVPFWRAAGMTYITYSNLCANMVRNCLKEPYRAEALSREKVHFSFSKWVDGKPQK 60 Query: 367 PTIRSDTPEE 338 P IRSDT EE Sbjct: 61 PAIRSDTGEE 70 >gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] Length = 70 Score = 130 bits (327), Expect = 3e-28 Identities = 58/70 (82%), Positives = 66/70 (94%) Frame = -2 Query: 547 MASNAAVPFWRAAGMTYITYSNLCANLVRNCLKEPHRSEALNREKVHFAATKWVDGKPLK 368 M SNAAVPFWRAAGMTYITYSN+CANLVRNCLKEP+++EAL+REKVHF+ +KW DGKP K Sbjct: 1 MTSNAAVPFWRAAGMTYITYSNICANLVRNCLKEPYKTEALSREKVHFSISKWTDGKPEK 60 Query: 367 PTIRSDTPEE 338 PTIRSD+PEE Sbjct: 61 PTIRSDSPEE 70 >ref|XP_004141742.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Cucumis sativus] Length = 70 Score = 129 bits (323), Expect = 7e-28 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = -2 Query: 547 MASNAAVPFWRAAGMTYITYSNLCANLVRNCLKEPHRSEALNREKVHFAATKWVDGKPLK 368 MAS+AAVPFWRAAGMTYITYSN+CANLVRNCLKEP+++E L REKVHF+ KWVDGKP K Sbjct: 1 MASSAAVPFWRAAGMTYITYSNICANLVRNCLKEPYKTEVLKREKVHFSVAKWVDGKPQK 60 Query: 367 PTIRSDTPE 341 PT+RSDTPE Sbjct: 61 PTLRSDTPE 69 >ref|NP_175576.1| ATP synthase subunit epsilon [Arabidopsis thaliana] gi|2493052|sp|Q96253.3|ATP5E_ARATH RecName: Full=ATP synthase subunit epsilon, mitochondrial; Short=ATPase subunit epsilon gi|12321688|gb|AAG50890.1|AC025294_28 epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|1655486|dbj|BAA13602.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|18252167|gb|AAL61916.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|21386911|gb|AAM47859.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|332194574|gb|AEE32695.1| ATP synthase subunit epsilon [Arabidopsis thaliana] Length = 70 Score = 129 bits (323), Expect = 7e-28 Identities = 56/69 (81%), Positives = 64/69 (92%) Frame = -2 Query: 547 MASNAAVPFWRAAGMTYITYSNLCANLVRNCLKEPHRSEALNREKVHFAATKWVDGKPLK 368 MASNAAVPFWRAAGMTYI+YSN+CAN+VRNCLKEPH++EAL REKVHF+ +KW DGKP K Sbjct: 1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQK 60 Query: 367 PTIRSDTPE 341 P +RSDTPE Sbjct: 61 PVLRSDTPE 69