BLASTX nr result
ID: Cephaelis21_contig00010274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00010274 (784 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR25551.1| serine incorporator 3 [Oryza sativa Indica Group] 40 6e-06 >gb|ABR25551.1| serine incorporator 3 [Oryza sativa Indica Group] Length = 220 Score = 40.0 bits (92), Expect(2) = 6e-06 Identities = 23/68 (33%), Positives = 30/68 (44%) Frame = +3 Query: 579 VFAFVMVTLHPTVSFFYFIMLNKVIKHRSGSI*SF*ILNK*VYRSILPFSIILLYCMHLC 758 VF F +V LHP ++ S+LP S+I LYC +LC Sbjct: 32 VFVFAIVALHPKIN-----------------------------GSLLPASVIALYCTYLC 62 Query: 759 YSGRASEP 782 YSG +SEP Sbjct: 63 YSGLSSEP 70 Score = 36.2 bits (82), Expect(2) = 6e-06 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +2 Query: 509 FYLFTASGHDCRLNTYFIMLTLICLCI 589 F+ FT SGHDC +N +FI+ TLI + + Sbjct: 8 FHWFTPSGHDCGINLFFIVFTLILVFV 34