BLASTX nr result
ID: Cephaelis21_contig00009945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00009945 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD28426.2| RNA-directed DNA polymerase (Reverse transcriptas... 99 4e-19 emb|CCH50976.1| T4.15 [Malus x robusta] 98 6e-19 gb|AEL30371.1| TIR-NBS-LRR type disease resistance protein [Arac... 96 4e-18 gb|AEL30341.1| RNA-directed DNA polymerase [Arachis hypogaea] 94 1e-17 emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 89 4e-16 >gb|ABD28426.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 517 Score = 99.0 bits (245), Expect = 4e-19 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 1/90 (1%) Frame = -1 Query: 284 NQMKVIAKRVLGESKSH-KWNKESWWWNQDIQEKVKAKRASYKTLYTCKNDENLEKYKIA 108 +++K +AK LGES+ KESWWWN ++Q KV+ KR +K CKN E +KYKIA Sbjct: 7 HEIKKVAKETLGESRGFGPRGKESWWWNDNVQSKVRIKRDCFKDWSRCKNVETWDKYKIA 66 Query: 107 KKEVRRVISEAKTKTFEEFYKRLDTKEGEK 18 +KE ++V+SEA+T+ FE Y+ L TKEGEK Sbjct: 67 RKEAKKVVSEARTQAFEGLYQSLGTKEGEK 96 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 98.2 bits (243), Expect = 6e-19 Identities = 45/87 (51%), Positives = 62/87 (71%), Gaps = 1/87 (1%) Frame = -1 Query: 278 MKVIAKRVLGESKSHK-WNKESWWWNQDIQEKVKAKRASYKTLYTCKNDENLEKYKIAKK 102 ++ +AK VLGESK KESWWWN+++Q KVKAK+ K LY + DEN E+Y+ AK+ Sbjct: 397 IRKVAKEVLGESKGFAPHQKESWWWNEEVQTKVKAKKECCKALYKDRTDENGERYRKAKQ 456 Query: 101 EVRRVISEAKTKTFEEFYKRLDTKEGE 21 E ++ + EAK +++ YKRLDTKEGE Sbjct: 457 EAKKAVREAKLAAYDDMYKRLDTKEGE 483 >gb|AEL30371.1| TIR-NBS-LRR type disease resistance protein [Arachis hypogaea] Length = 1939 Score = 95.5 bits (236), Expect = 4e-18 Identities = 46/84 (54%), Positives = 57/84 (67%), Gaps = 1/84 (1%) Frame = -1 Query: 266 AKRVLGESKS-HKWNKESWWWNQDIQEKVKAKRASYKTLYTCKNDENLEKYKIAKKEVRR 90 AK GESK +KESWWWN IQEK+K KR +K C+N +N EKYK AKKE + Sbjct: 800 AKESFGESKGIGPRDKESWWWNASIQEKIKIKRECFKEWSLCRNVDNWEKYKAAKKETKV 859 Query: 89 VISEAKTKTFEEFYKRLDTKEGEK 18 +SEA+T+ +E Y+ LDTKEGEK Sbjct: 860 AVSEARTRAYEGLYQSLDTKEGEK 883 >gb|AEL30341.1| RNA-directed DNA polymerase [Arachis hypogaea] Length = 97 Score = 93.6 bits (231), Expect = 1e-17 Identities = 45/84 (53%), Positives = 56/84 (66%), Gaps = 1/84 (1%) Frame = -1 Query: 266 AKRVLGESKS-HKWNKESWWWNQDIQEKVKAKRASYKTLYTCKNDENLEKYKIAKKEVRR 90 AK GESK +KESWWWN IQEK+K KR +K C+N +N EKYK AKKE + Sbjct: 9 AKENFGESKGIGPRDKESWWWNASIQEKIKIKRECFKEWSLCRNADNWEKYKAAKKETKV 68 Query: 89 VISEAKTKTFEEFYKRLDTKEGEK 18 +SEA+T+ +E Y+ L TKEGEK Sbjct: 69 AVSEARTRAYESLYQSLGTKEGEK 92 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus x domestica] Length = 622 Score = 89.0 bits (219), Expect = 4e-16 Identities = 44/87 (50%), Positives = 60/87 (68%), Gaps = 1/87 (1%) Frame = -1 Query: 278 MKVIAKRVLGESKSHKWN-KESWWWNQDIQEKVKAKRASYKTLYTCKNDENLEKYKIAKK 102 ++ +AK VLGESK + KESWWWN E+VKAK+ K LY + DEN E+Y+ AK+ Sbjct: 5 IRKVAKEVLGESKGFATHQKESWWWN----EEVKAKKECCKALYKDRTDENGERYRKAKQ 60 Query: 101 EVRRVISEAKTKTFEEFYKRLDTKEGE 21 E ++ + EAK +++ YKRLDTKEGE Sbjct: 61 EAKKAVREAKLAAYDDMYKRLDTKEGE 87