BLASTX nr result
ID: Cephaelis21_contig00009760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00009760 (714 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD48963.1|AF147263_5 contains similarity to transposases [Ar... 64 6e-15 gb|AAF19546.1|AC007190_14 F23N19.13 [Arabidopsis thaliana] 67 1e-14 gb|AAD24567.1|AF120335_1 putative transposase [Arabidopsis thali... 67 2e-14 dbj|BAB01989.1| unnamed protein product [Arabidopsis thaliana] 67 2e-14 gb|AAD43146.1|AC007504_1 Hypothetical Protein [Arabidopsis thali... 70 2e-14 >gb|AAD48963.1|AF147263_5 contains similarity to transposases [Arabidopsis thaliana] gi|7267311|emb|CAB81093.1| AT4g05510 [Arabidopsis thaliana] Length = 604 Score = 63.5 bits (153), Expect(2) = 6e-15 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -1 Query: 186 LSLMARDVLSIPITTVASESAFSHGGRILGTYRTSILPENVEAII*SRDWL 34 L+ MA DVLSIPIT+VASES+FS G +L YR+ +LP NV+A++ +R WL Sbjct: 532 LAYMAMDVLSIPITSVASESSFSIGSHVLNKYRSRLLPTNVQALLCTRSWL 582 Score = 43.1 bits (100), Expect(2) = 6e-15 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = -3 Query: 292 KSELELYLDERLVDHKQHPNLDVLNYWKDCVVRF*PFTY 176 KS L++YL++ ++ K HPNL+VL YWK+ +RF Y Sbjct: 496 KSALDMYLEDPKLEMKNHPNLNVLQYWKENRLRFGALAY 534 >gb|AAF19546.1|AC007190_14 F23N19.13 [Arabidopsis thaliana] Length = 633 Score = 67.4 bits (163), Expect(2) = 1e-14 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = -1 Query: 189 DLSLMARDVLSIPITTVASESAFSHGGRILGTYRTSILPENVEAII*SRDW 37 +LS MA D+LSIPITTVASESAFS G R+L YR+ +LP NV+A++ +R+W Sbjct: 545 ELSSMACDILSIPITTVASESAFSIGSRVLNKYRSCLLPTNVQALLCTRNW 595 Score = 38.1 bits (87), Expect(2) = 1e-14 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = -3 Query: 331 FDSYMS*YGNTISKSELELYLDERLVDHKQHPNLDVLNYWKDCVVRF 191 F SY S N KS L++YL+E ++D ++DV+ YWK+ V RF Sbjct: 498 FYSYFS-QRNGTGKSPLDMYLEEPVLDMVSFKDMDVIAYWKNNVSRF 543 >gb|AAD24567.1|AF120335_1 putative transposase [Arabidopsis thaliana] Length = 577 Score = 67.4 bits (163), Expect(2) = 2e-14 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = -1 Query: 189 DLSLMARDVLSIPITTVASESAFSHGGRILGTYRTSILPENVEAII*SRDW 37 +LS MA D+LSIPITTVASESAFS G R+L YR+ +LP NV+A++ +R+W Sbjct: 489 ELSSMACDILSIPITTVASESAFSIGSRVLNKYRSCLLPTNVQALLCTRNW 539 Score = 37.7 bits (86), Expect(2) = 2e-14 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = -3 Query: 331 FDSYMS*YGNTISKSELELYLDERLVDHKQHPNLDVLNYWKDCVVRF 191 F SY S N KS L++YL+E ++D ++DV+ YWK+ V RF Sbjct: 442 FYSYFS-QRNGTGKSPLDMYLEEPVLDMVSFRDMDVIAYWKNNVSRF 487 >dbj|BAB01989.1| unnamed protein product [Arabidopsis thaliana] Length = 191 Score = 67.4 bits (163), Expect(2) = 2e-14 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = -1 Query: 189 DLSLMARDVLSIPITTVASESAFSHGGRILGTYRTSILPENVEAII*SRDW 37 +LS MA D+LSIPITTVASESAFS G R+L YR+ +LP NV+A++ +R+W Sbjct: 118 ELSSMACDILSIPITTVASESAFSIGSRVLNKYRSCLLPTNVQALLCTRNW 168 Score = 37.7 bits (86), Expect(2) = 2e-14 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = -3 Query: 331 FDSYMS*YGNTISKSELELYLDERLVDHKQHPNLDVLNYWKDCVVRF 191 F SY S N KS L++YL+E ++D ++DV+ YWK+ V RF Sbjct: 71 FYSYFS-QRNGTGKSPLDMYLEEPVLDMVSFRDMDVIAYWKNNVSRF 116 >gb|AAD43146.1|AC007504_1 Hypothetical Protein [Arabidopsis thaliana] Length = 258 Score = 70.1 bits (170), Expect(2) = 2e-14 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = -1 Query: 189 DLSLMARDVLSIPITTVASESAFSHGGRILGTYRTSILPENVEAII*SRDWL 34 +LS MA DVLSIPITTVASES+FS G +L YR+S+LPEN++A+I +R+WL Sbjct: 180 ELSSMACDVLSIPITTVASESSFSIGSGVLSKYRSSLLPENIQALICTRNWL 231 Score = 34.7 bits (78), Expect(2) = 2e-14 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = -3 Query: 331 FDSYMS*YGNTISKSELELYLDERLVDHKQHPNLDVLNYWKDCVVRF 191 F +++S + KSEL++YL E +D + +VL YWKD RF Sbjct: 132 FYAFVSQKVGSSGKSELDIYLGEPTLDMAAFRHFNVLAYWKDNSCRF 178