BLASTX nr result
ID: Cephaelis21_contig00009626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00009626 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_194298.1| PPPDE putative thiol peptidase family protein [... 58 7e-07 ref|XP_002869660.1| hypothetical protein ARALYDRAFT_492258 [Arab... 58 7e-07 ref|XP_004140760.1| PREDICTED: deSI-like protein At4g17486-like ... 57 1e-06 ref|XP_003548162.1| PREDICTED: UPF0326 protein At4g17486-like [G... 57 1e-06 ref|XP_002305910.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|NP_194298.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana] gi|4914460|emb|CAB43699.1| putative protein [Arabidopsis thaliana] gi|7269418|emb|CAB81378.1| putative protein [Arabidopsis thaliana] gi|21537182|gb|AAM61523.1| unknown [Arabidopsis thaliana] gi|27808564|gb|AAO24562.1| At4g25680 [Arabidopsis thaliana] gi|110743598|dbj|BAE99636.1| hypothetical protein [Arabidopsis thaliana] gi|332659694|gb|AEE85094.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana] Length = 252 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 90 MTEVILHIYDVTNSGSDKTNNTVMQINRIF 1 MTEV+LHIYDVTNSGS+KTNNT++QINR F Sbjct: 1 MTEVVLHIYDVTNSGSEKTNNTIVQINRFF 30 >ref|XP_002869660.1| hypothetical protein ARALYDRAFT_492258 [Arabidopsis lyrata subsp. lyrata] gi|297315496|gb|EFH45919.1| hypothetical protein ARALYDRAFT_492258 [Arabidopsis lyrata subsp. lyrata] Length = 252 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 90 MTEVILHIYDVTNSGSDKTNNTVMQINRIF 1 MTEV+LHIYDVTNSGS+KTNNT++QINR F Sbjct: 1 MTEVVLHIYDVTNSGSEKTNNTIVQINRFF 30 >ref|XP_004140760.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus] gi|449485477|ref|XP_004157182.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus] Length = 251 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 90 MTEVILHIYDVTNSGSDKTNNTVMQINRIF 1 MT+VILHIYDVTNSGSDKTNNT++ IN+IF Sbjct: 1 MTDVILHIYDVTNSGSDKTNNTIVNINKIF 30 >ref|XP_003548162.1| PREDICTED: UPF0326 protein At4g17486-like [Glycine max] Length = 245 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -1 Query: 90 MTEVILHIYDVTNSGSDKTNNTVMQINRIF 1 MT+V+LHIYDVTNSGS+KTNNT++QIN+IF Sbjct: 1 MTDVVLHIYDVTNSGSEKTNNTIVQINKIF 30 >ref|XP_002305910.1| predicted protein [Populus trichocarpa] gi|222848874|gb|EEE86421.1| predicted protein [Populus trichocarpa] Length = 268 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 90 MTEVILHIYDVTNSGSDKTNNTVMQINRIF 1 MTEVILH+YDVTNSGS+KTNNT++ IN+IF Sbjct: 1 MTEVILHVYDVTNSGSEKTNNTILNINKIF 30