BLASTX nr result
ID: Cephaelis21_contig00009518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00009518 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277667.2| PREDICTED: uncharacterized protein LOC100246... 58 7e-07 emb|CBI31609.3| unnamed protein product [Vitis vinifera] 58 7e-07 >ref|XP_002277667.2| PREDICTED: uncharacterized protein LOC100246247 [Vitis vinifera] Length = 805 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +3 Query: 84 EAWGGEKFTDKLYQLRHSVNVPSRFATLNTASVTSGSMFSALQDI 218 EAWGGE+ +DK R S N+PSRF L T+ +TSGSM S LQD+ Sbjct: 531 EAWGGERLSDKFAHHRQSANLPSRFGMLTTSGLTSGSMLSGLQDL 575 >emb|CBI31609.3| unnamed protein product [Vitis vinifera] Length = 779 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +3 Query: 84 EAWGGEKFTDKLYQLRHSVNVPSRFATLNTASVTSGSMFSALQDI 218 EAWGGE+ +DK R S N+PSRF L T+ +TSGSM S LQD+ Sbjct: 505 EAWGGERLSDKFAHHRQSANLPSRFGMLTTSGLTSGSMLSGLQDL 549