BLASTX nr result
ID: Cephaelis21_contig00008770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00008770 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADX60609.1| transcriptional activator [Blueberry red ringspot... 57 2e-06 gb|AEQ49590.1| transciptional activator [Blueberry red ringspot ... 56 3e-06 gb|ADX60607.2| transcriptional activator [Blueberry red ringspot... 56 3e-06 gb|ADX60605.2| transcriptional activator [Blueberry red ringspot... 56 3e-06 gb|ADX60614.1| transcriptional activator [Blueberry red ringspot... 56 3e-06 >gb|ADX60609.1| transcriptional activator [Blueberry red ringspot virus] Length = 151 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/65 (43%), Positives = 35/65 (53%) Frame = +2 Query: 74 KYYVVFNGPLAGIYNSWSETAKIVNGTKGAIHKSFKTKDEALSEFQAFTKQPANSYAATL 253 +YYV+FNGP+ GIY+ W + A + G IHK + T DEA K SYAA Sbjct: 11 EYYVIFNGPMKGIYDEWHKAAPYIQGQSNIIHKKYPTIDEA-------KKALGGSYAAIT 63 Query: 254 KRPAS 268 PAS Sbjct: 64 NAPAS 68 >gb|AEQ49590.1| transciptional activator [Blueberry red ringspot virus] Length = 427 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/65 (43%), Positives = 35/65 (53%) Frame = +2 Query: 74 KYYVVFNGPLAGIYNSWSETAKIVNGTKGAIHKSFKTKDEALSEFQAFTKQPANSYAATL 253 +YYV+FNGP+ GIY+ W + A + G IHK + T DEA K SYAA Sbjct: 81 EYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKYPTIDEA-------KKALGGSYAAIT 133 Query: 254 KRPAS 268 PAS Sbjct: 134 NAPAS 138 >gb|ADX60607.2| transcriptional activator [Blueberry red ringspot virus] Length = 427 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/65 (43%), Positives = 35/65 (53%) Frame = +2 Query: 74 KYYVVFNGPLAGIYNSWSETAKIVNGTKGAIHKSFKTKDEALSEFQAFTKQPANSYAATL 253 +YYV+FNGP+ GIY+ W + A + G IHK + T DEA K SYAA Sbjct: 81 EYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKYPTIDEA-------KKALGGSYAAIT 133 Query: 254 KRPAS 268 PAS Sbjct: 134 NAPAS 138 >gb|ADX60605.2| transcriptional activator [Blueberry red ringspot virus] Length = 427 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/65 (43%), Positives = 35/65 (53%) Frame = +2 Query: 74 KYYVVFNGPLAGIYNSWSETAKIVNGTKGAIHKSFKTKDEALSEFQAFTKQPANSYAATL 253 +YYV+FNGP+ GIY+ W + A + G IHK + T DEA K SYAA Sbjct: 81 EYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKYPTIDEA-------KKALGGSYAAIT 133 Query: 254 KRPAS 268 PAS Sbjct: 134 NAPAS 138 >gb|ADX60614.1| transcriptional activator [Blueberry red ringspot virus] Length = 149 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/65 (43%), Positives = 35/65 (53%) Frame = +2 Query: 74 KYYVVFNGPLAGIYNSWSETAKIVNGTKGAIHKSFKTKDEALSEFQAFTKQPANSYAATL 253 +YYV+FNGP+ GIY+ W + A + G IHK + T DEA K SYAA Sbjct: 11 EYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKYPTIDEA-------KKALGGSYAAIT 63 Query: 254 KRPAS 268 PAS Sbjct: 64 NAPAS 68