BLASTX nr result
ID: Cephaelis21_contig00008741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00008741 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ38405.1| embryo-specific protein 3 [Plantago major] 56 4e-06 >emb|CAJ38405.1| embryo-specific protein 3 [Plantago major] Length = 96 Score = 55.8 bits (133), Expect = 4e-06 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -1 Query: 345 TVYGYNTNPVTFHYDVYIPRDTWYGFNNCDR 253 T+YGYN+ PVTF+Y+V IP D WYGFN C R Sbjct: 61 TIYGYNSQPVTFYYNVNIPGDIWYGFNQCSR 91