BLASTX nr result
ID: Cephaelis21_contig00008715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00008715 (578 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum] 70 2e-10 ref|XP_003546691.1| PREDICTED: 60S ribosomal protein L11-like is... 70 2e-10 ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [G... 70 2e-10 ref|XP_003526218.1| PREDICTED: 60S ribosomal protein L11-like [G... 70 2e-10 ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycin... 70 2e-10 >emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum] Length = 181 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 108 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 36 >ref|XP_003546691.1| PREDICTED: 60S ribosomal protein L11-like isoform 2 [Glycine max] Length = 169 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 108 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 36 >ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 181 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 108 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 36 >ref|XP_003526218.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 176 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 108 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 36 >ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycine max] gi|356517806|ref|XP_003527577.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] gi|356556759|ref|XP_003546690.1| PREDICTED: 60S ribosomal protein L11-like isoform 1 [Glycine max] gi|255627231|gb|ACU13960.1| unknown [Glycine max] gi|255648308|gb|ACU24606.1| unknown [Glycine max] Length = 181 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 108 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAA 36