BLASTX nr result
ID: Cephaelis21_contig00008569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00008569 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF47193.1| embryonic element binding Factor 7 [Daucus carota] 64 1e-08 gb|ADZ28107.1| ethylene response factor 4 [Malus x domestica] 55 8e-06 gb|ADE41144.1| AP2 domain class transcription factor [Malus x do... 55 8e-06 ref|XP_002533146.1| DNA binding protein, putative [Ricinus commu... 54 1e-05 >dbj|BAF47193.1| embryonic element binding Factor 7 [Daucus carota] Length = 320 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 454 SSPESGNTFLDFAEPTFDESDNFLLLKFPSVEIDWASLYNSM 329 SSPES +FLDF+EP FDES+NF+L KFPSVEIDW +L +S+ Sbjct: 277 SSPESEISFLDFSEPCFDESENFMLQKFPSVEIDWEALTSSL 318 >gb|ADZ28107.1| ethylene response factor 4 [Malus x domestica] Length = 323 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -3 Query: 484 RSDETSSLEMSSPESGNTFLDFAEPTFDESDNFLLLKFPSVEIDWASL 341 RSDE+SS PES TFLDF++ +DE++NF L K+PSVEIDW+++ Sbjct: 281 RSDESSS-----PESDITFLDFSDSQWDEAENFGLEKYPSVEIDWSAI 323 >gb|ADE41144.1| AP2 domain class transcription factor [Malus x domestica] Length = 323 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -3 Query: 484 RSDETSSLEMSSPESGNTFLDFAEPTFDESDNFLLLKFPSVEIDWASL 341 RSDE+SS PES TFLDF++ +DE++NF L K+PSVEIDW+++ Sbjct: 281 RSDESSS-----PESDITFLDFSDSQWDEAENFGLEKYPSVEIDWSAI 323 >ref|XP_002533146.1| DNA binding protein, putative [Ricinus communis] gi|223527057|gb|EEF29242.1| DNA binding protein, putative [Ricinus communis] Length = 374 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/49 (57%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = -3 Query: 481 SDETSSLEMSSPESGNTFLDFAEPT--FDESDNFLLLKFPSVEIDWASL 341 S + SS SSP+S +FLDF++ + +DES+NF L K+PSVEIDWASL Sbjct: 326 SSDESSAGSSSPQSEISFLDFSDSSSQWDESENFCLEKYPSVEIDWASL 374