BLASTX nr result
ID: Cephaelis21_contig00007728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00007728 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ84988.1| unknown [Medicago truncatula] 63 2e-08 ref|XP_003604655.1| Glutamine amidotransferase subunit pdxT [Med... 63 2e-08 ref|XP_004171955.1| PREDICTED: pyridoxal biosynthesis protein PD... 62 5e-08 ref|XP_004145736.1| PREDICTED: pyridoxal biosynthesis protein PD... 62 5e-08 ref|NP_568922.1| Pyridoxal biosynthesis protein PDX2 [Arabidopsi... 62 6e-08 >gb|ACJ84988.1| unknown [Medicago truncatula] Length = 252 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 89 FPALREFVKMGKPVWGTCAGLIFLADKAT 3 FPALREFV+MGKPVWGTCAGLIFLADKAT Sbjct: 62 FPALREFVQMGKPVWGTCAGLIFLADKAT 90 >ref|XP_003604655.1| Glutamine amidotransferase subunit pdxT [Medicago truncatula] gi|355505710|gb|AES86852.1| Glutamine amidotransferase subunit pdxT [Medicago truncatula] gi|388521797|gb|AFK48960.1| unknown [Medicago truncatula] Length = 252 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 89 FPALREFVKMGKPVWGTCAGLIFLADKAT 3 FPALREFV+MGKPVWGTCAGLIFLADKAT Sbjct: 62 FPALREFVQMGKPVWGTCAGLIFLADKAT 90 >ref|XP_004171955.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Cucumis sativus] Length = 250 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = -2 Query: 131 GDENLELCSLL*LQ--FPALREFVKMGKPVWGTCAGLIFLADKAT 3 G E+ + L L FPALREFV+MGKPVWGTCAGLIFLA+KAT Sbjct: 46 GGESTTMAKLAELHNLFPALREFVRMGKPVWGTCAGLIFLANKAT 90 >ref|XP_004145736.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Cucumis sativus] Length = 250 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = -2 Query: 131 GDENLELCSLL*LQ--FPALREFVKMGKPVWGTCAGLIFLADKAT 3 G E+ + L L FPALREFV+MGKPVWGTCAGLIFLA+KAT Sbjct: 46 GGESTTMAKLAELHNLFPALREFVRMGKPVWGTCAGLIFLANKAT 90 >ref|NP_568922.1| Pyridoxal biosynthesis protein PDX2 [Arabidopsis thaliana] gi|75154761|sp|Q8LAD0.1|PDX2_ARATH RecName: Full=Pyridoxal biosynthesis protein PDX2; AltName: Full=Probable glutamine amidotransferase; Short=AtPDX2; AltName: Full=Protein EMBRYO DEFECTIVE 2407 gi|21593486|gb|AAM65453.1| imidazoleglycerol-phosphate synthase subunit H-like [Arabidopsis thaliana] gi|26449721|dbj|BAC41984.1| putative imidazoleglycerol-phosphate synthase subunit H [Arabidopsis thaliana] gi|28950813|gb|AAO63330.1| At5g60540 [Arabidopsis thaliana] gi|332009958|gb|AED97341.1| Pyridoxal biosynthesis protein PDX2 [Arabidopsis thaliana] Length = 255 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 89 FPALREFVKMGKPVWGTCAGLIFLADKA 6 FPALREFVKMGKPVWGTCAGLIFLAD+A Sbjct: 61 FPALREFVKMGKPVWGTCAGLIFLADRA 88