BLASTX nr result
ID: Cephaelis21_contig00007496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00007496 (1310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30378.3| unnamed protein product [Vitis vinifera] 65 4e-08 ref|XP_002309393.1| predicted protein [Populus trichocarpa] gi|2... 61 7e-07 ref|XP_002534235.1| conserved hypothetical protein [Ricinus comm... 60 1e-06 >emb|CBI30378.3| unnamed protein product [Vitis vinifera] Length = 806 Score = 65.1 bits (157), Expect = 4e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 112 QDVVISFPLYEEALKFVHHREKMIQIAVRALTLNIYN 2 +DVV++FPLY EALKF +H EKMIQIAVRALTLNIYN Sbjct: 157 EDVVVAFPLYSEALKFAYHGEKMIQIAVRALTLNIYN 193 Score = 42.7 bits (99), Expect(2) = 8e-06 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 1009 ILHQYEFEGGDILPYYVSFLR 947 I HQYEF+GGD+ PYYVSFLR Sbjct: 118 ITHQYEFDGGDLAPYYVSFLR 138 Score = 34.3 bits (77), Expect(2) = 8e-06 Identities = 14/24 (58%), Positives = 21/24 (87%) Frame = -1 Query: 857 VIWLRAVTGKIDRDTVCLLAEVHK 786 V +LRAV+ K++RDT+CLL +VH+ Sbjct: 134 VSFLRAVSSKLNRDTLCLLVKVHE 157 >ref|XP_002309393.1| predicted protein [Populus trichocarpa] gi|222855369|gb|EEE92916.1| predicted protein [Populus trichocarpa] Length = 665 Score = 60.8 bits (146), Expect = 7e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 109 DVVISFPLYEEALKFVHHREKMIQIAVRALTLNIYN 2 D V+SFPLY EALKF H EKMIQ A+RALTLNIYN Sbjct: 158 DAVVSFPLYSEALKFAQHGEKMIQTAIRALTLNIYN 193 >ref|XP_002534235.1| conserved hypothetical protein [Ricinus communis] gi|223525663|gb|EEF28149.1| conserved hypothetical protein [Ricinus communis] Length = 763 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 109 DVVISFPLYEEALKFVHHREKMIQIAVRALTLNIYN 2 DV++SFPLY EALKF H EKMIQ AVRAL+LNIYN Sbjct: 158 DVLVSFPLYSEALKFAQHGEKMIQTAVRALSLNIYN 193