BLASTX nr result
ID: Cephaelis21_contig00007395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00007395 (781 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165590.1| PREDICTED: translation machinery-associated ... 78 2e-12 emb|CAH59409.1| hypothetical protein [Plantago major] 76 7e-12 gb|ADK13061.1| conserved hypothetical protein 4 [Hevea brasilien... 76 7e-12 ref|NP_563969.1| translation machinery associated protein TMA7 [... 75 2e-11 gb|ADK13065.1| conserved hypothetical protein 8 [Hevea brasilien... 75 2e-11 >ref|XP_004165590.1| PREDICTED: translation machinery-associated protein 7-like [Cucumis sativus] Length = 109 Score = 78.2 bits (191), Expect = 2e-12 Identities = 41/57 (71%), Positives = 45/57 (78%), Gaps = 3/57 (5%) Frame = -2 Query: 663 CFSLILA*NPA---AMSSKQGGKAKPLKQPKAEKKDYDENDKAFLQKKKDEEKAMKE 502 C L L NP+ AMSSKQGGKAKPLKQPK +KKDYDE D A +QKKKDEEKA+KE Sbjct: 31 CVLLRLGPNPSDISAMSSKQGGKAKPLKQPKVDKKDYDEVDMANMQKKKDEEKALKE 87 >emb|CAH59409.1| hypothetical protein [Plantago major] Length = 63 Score = 76.3 bits (186), Expect = 7e-12 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 627 MSSKQGGKAKPLKQPKAEKKDYDENDKAFLQKKKDEEKAMKE 502 MSSKQGGKAKPLKQPK+EKK+YDE DKA +QKKKDEEKA+KE Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDEIDKANIQKKKDEEKALKE 42 >gb|ADK13061.1| conserved hypothetical protein 4 [Hevea brasiliensis] Length = 64 Score = 76.3 bits (186), Expect = 7e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 627 MSSKQGGKAKPLKQPKAEKKDYDENDKAFLQKKKDEEKAMKE 502 MSSKQGGKAKPLKQPKAEKKDYDE D A +QKKK+EEKA+KE Sbjct: 1 MSSKQGGKAKPLKQPKAEKKDYDETDTANIQKKKEEEKALKE 42 >ref|NP_563969.1| translation machinery associated protein TMA7 [Arabidopsis thaliana] gi|297849952|ref|XP_002892857.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gi|5103825|gb|AAD39655.1|AC007591_20 ESTs gb|AA650895, gb|AA720043 and gb|R29777 come from this gene [Arabidopsis thaliana] gi|12484215|gb|AAG54006.1|AF336925_1 unknown protein [Arabidopsis thaliana] gi|15028107|gb|AAK76677.1| unknown protein [Arabidopsis thaliana] gi|17065256|gb|AAL32782.1| Unknown protein [Arabidopsis thaliana] gi|20260078|gb|AAM13386.1| unknown protein [Arabidopsis thaliana] gi|21592316|gb|AAM64267.1| unknown [Arabidopsis thaliana] gi|297338699|gb|EFH69116.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gi|332191176|gb|AEE29297.1| translation machinery associated protein TMA7 [Arabidopsis thaliana] Length = 64 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 627 MSSKQGGKAKPLKQPKAEKKDYDENDKAFLQKKKDEEKAMKE 502 MSSKQGGKAKPLKQPKA+KK+YDE D A +QKKKDEEKA+KE Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDETDLANIQKKKDEEKALKE 42 >gb|ADK13065.1| conserved hypothetical protein 8 [Hevea brasiliensis] Length = 64 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 627 MSSKQGGKAKPLKQPKAEKKDYDENDKAFLQKKKDEEKAMKE 502 MSSKQGGKAKPL+QPKAEKKDYDE D A +QKKK+EEKA+KE Sbjct: 1 MSSKQGGKAKPLEQPKAEKKDYDETDTANIQKKKEEEKALKE 42