BLASTX nr result
ID: Cephaelis21_contig00007214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00007214 (573 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63472.1| ethylene receptor [Coffea liberica var. dewevrei] 75 1e-11 gb|ABL63473.1| ethylene receptor [Coffea pseudozanguebariae] 75 1e-11 gb|ABL63471.1| ethylene receptor [Coffea canephora] 75 1e-11 gb|ABL63474.1| ethylene receptor isoform 1 [Coffea canephora] gi... 75 1e-11 sp|Q9M7M1.1|ETR1_PRUPE RecName: Full=Ethylene receptor gi|684107... 69 7e-10 >gb|ABL63472.1| ethylene receptor [Coffea liberica var. dewevrei] Length = 740 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 3/50 (6%) Frame = +3 Query: 3 VKLGIRGRSNEAKLTYMSRATANHVRTNFPGLKVVLMDDNG---LVTNGL 143 VKLG+RGRSNEAKL Y+SRA NHVRTNF GLKV++MDDNG +VT GL Sbjct: 582 VKLGLRGRSNEAKLQYVSRAPVNHVRTNFTGLKVIVMDDNGVSRMVTKGL 631 >gb|ABL63473.1| ethylene receptor [Coffea pseudozanguebariae] Length = 740 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 3/50 (6%) Frame = +3 Query: 3 VKLGIRGRSNEAKLTYMSRATANHVRTNFPGLKVVLMDDNG---LVTNGL 143 VKLG+RGRSNEAKL Y+SRA NHVRTNF GLKV++MDDNG +VT GL Sbjct: 582 VKLGLRGRSNEAKLQYVSRAPVNHVRTNFTGLKVIVMDDNGVSRMVTRGL 631 >gb|ABL63471.1| ethylene receptor [Coffea canephora] Length = 740 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 3/50 (6%) Frame = +3 Query: 3 VKLGIRGRSNEAKLTYMSRATANHVRTNFPGLKVVLMDDNG---LVTNGL 143 VKLG+RGRSNEAKL Y+SRA NHVRTNF GLKV++MDDNG +VT GL Sbjct: 582 VKLGLRGRSNEAKLQYVSRAPVNHVRTNFTGLKVIVMDDNGVSRMVTKGL 631 >gb|ABL63474.1| ethylene receptor isoform 1 [Coffea canephora] gi|119351161|gb|ABL63475.1| ethylene receptor isoform 2 [Coffea canephora] gi|119351163|gb|ABL63476.1| ethylene receptor isoform 3 [Coffea canephora] Length = 740 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 3/50 (6%) Frame = +3 Query: 3 VKLGIRGRSNEAKLTYMSRATANHVRTNFPGLKVVLMDDNG---LVTNGL 143 VKLG+RGRSNEAKL Y+SRA NHVRTNF GLKV++MDDNG +VT GL Sbjct: 582 VKLGLRGRSNEAKLQYVSRAPVNHVRTNFTGLKVIVMDDNGVSRMVTKGL 631 >sp|Q9M7M1.1|ETR1_PRUPE RecName: Full=Ethylene receptor gi|6841075|gb|AAF28893.1|AF124527_1 ethylene receptor [Prunus persica] Length = 738 Score = 68.6 bits (166), Expect = 7e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +3 Query: 3 VKLGIRGRSNEAKLTYMSRATANHVRTNFPGLKVVLMDDNGLVTNGL 143 VKLG RSNE+KL ++++ ANHV+TNFPGLKV++MDDNG VT GL Sbjct: 583 VKLGFAERSNESKLPFLTKVQANHVQTNFPGLKVLVMDDNGSVTKGL 629