BLASTX nr result
ID: Cephaelis21_contig00004430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00004430 (1107 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283035.1| PREDICTED: uncharacterized protein LOC100243... 64 5e-08 ref|XP_004147791.1| PREDICTED: uncharacterized protein LOC101205... 57 6e-06 >ref|XP_002283035.1| PREDICTED: uncharacterized protein LOC100243809 [Vitis vinifera] gi|302142468|emb|CBI19671.3| unnamed protein product [Vitis vinifera] Length = 638 Score = 64.3 bits (155), Expect = 5e-08 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -1 Query: 504 AVSENSSIPAKLSAGPSHAPLAANNFEAFLKVPEFLRPHSQIYCTS 367 A + ++ I +GPS APLA+NNFEAF+KVP+FLRPH+QIYCTS Sbjct: 417 AYARDARILTTYYSGPSDAPLASNNFEAFVKVPKFLRPHTQIYCTS 462 >ref|XP_004147791.1| PREDICTED: uncharacterized protein LOC101205217 [Cucumis sativus] gi|449476778|ref|XP_004154831.1| PREDICTED: uncharacterized LOC101205217 [Cucumis sativus] Length = 649 Score = 57.4 bits (137), Expect = 6e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 462 GPSHAPLAANNFEAFLKVPEFLRPHSQIYCTS 367 GPS APLA FEAF+KVP FLRPH+QIYCTS Sbjct: 442 GPSDAPLAPTTFEAFVKVPSFLRPHTQIYCTS 473