BLASTX nr result
ID: Cephaelis21_contig00004147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00004147 (2329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529611.1| PREDICTED: uncharacterized protein LOC100804... 133 2e-28 ref|NP_001189822.1| heavy-metal-associated domain-containing pro... 133 2e-28 ref|XP_002884560.1| hypothetical protein ARALYDRAFT_477915 [Arab... 133 2e-28 ref|NP_566273.1| heavy-metal-associated domain-containing protei... 133 2e-28 ref|NP_850851.1| heavy metal transport/detoxification domain-con... 132 4e-28 >ref|XP_003529611.1| PREDICTED: uncharacterized protein LOC100804757 [Glycine max] Length = 490 Score = 133 bits (335), Expect = 2e-28 Identities = 63/78 (80%), Positives = 69/78 (88%) Frame = +2 Query: 497 MSKEEILKVQTCVLKVNIHCDGCKHKVKKILQKIEGVYKTTIDSELGKVTVCGIIDPDTL 676 MSKEE LK+Q CVLKVNIHCDGCKHKVKKILQKI+GV+ T ID+E GKVTV G +DP+ L Sbjct: 1 MSKEEFLKIQKCVLKVNIHCDGCKHKVKKILQKIDGVFTTEIDAEQGKVTVSGNVDPNVL 60 Query: 677 IKKLAKSGKRAELWGAPK 730 IKKLAKSGK AELWGAPK Sbjct: 61 IKKLAKSGKHAELWGAPK 78 >ref|NP_001189822.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|332640828|gb|AEE74349.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Length = 349 Score = 133 bits (335), Expect = 2e-28 Identities = 63/78 (80%), Positives = 68/78 (87%) Frame = +2 Query: 497 MSKEEILKVQTCVLKVNIHCDGCKHKVKKILQKIEGVYKTTIDSELGKVTVCGIIDPDTL 676 MSKEE +K+QTCVLKVNIHCDGCK KVKKILQKIEGV+ T IDSE GKVTV G +DP L Sbjct: 1 MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVL 60 Query: 677 IKKLAKSGKRAELWGAPK 730 IKKLAKSGK AE+WGAPK Sbjct: 61 IKKLAKSGKHAEIWGAPK 78 >ref|XP_002884560.1| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] gi|297330400|gb|EFH60819.1| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] Length = 445 Score = 133 bits (335), Expect = 2e-28 Identities = 63/78 (80%), Positives = 68/78 (87%) Frame = +2 Query: 497 MSKEEILKVQTCVLKVNIHCDGCKHKVKKILQKIEGVYKTTIDSELGKVTVCGIIDPDTL 676 MSKEE +K+QTCVLKVNIHCDGCK KVKKILQKIEGV+ T IDSE GKVTV G +DP L Sbjct: 1 MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVL 60 Query: 677 IKKLAKSGKRAELWGAPK 730 IKKLAKSGK AE+WGAPK Sbjct: 61 IKKLAKSGKHAEIWGAPK 78 >ref|NP_566273.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|6862917|gb|AAF30306.1|AC018907_6 hypothetical protein [Arabidopsis thaliana] gi|11908104|gb|AAG41481.1|AF326899_1 unknown protein [Arabidopsis thaliana] gi|13194808|gb|AAK15566.1|AF349519_1 unknown protein [Arabidopsis thaliana] gi|15010768|gb|AAK74043.1| AT3g06130/F28L1_7 [Arabidopsis thaliana] gi|23506209|gb|AAN31116.1| At3g06130/F28L1_7 [Arabidopsis thaliana] gi|332640827|gb|AEE74348.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Length = 473 Score = 133 bits (335), Expect = 2e-28 Identities = 63/78 (80%), Positives = 68/78 (87%) Frame = +2 Query: 497 MSKEEILKVQTCVLKVNIHCDGCKHKVKKILQKIEGVYKTTIDSELGKVTVCGIIDPDTL 676 MSKEE +K+QTCVLKVNIHCDGCK KVKKILQKIEGV+ T IDSE GKVTV G +DP L Sbjct: 1 MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVL 60 Query: 677 IKKLAKSGKRAELWGAPK 730 IKKLAKSGK AE+WGAPK Sbjct: 61 IKKLAKSGKHAEIWGAPK 78 >ref|NP_850851.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|238481311|ref|NP_001154719.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005268|gb|AED92651.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005269|gb|AED92652.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Length = 465 Score = 132 bits (332), Expect = 4e-28 Identities = 62/78 (79%), Positives = 68/78 (87%) Frame = +2 Query: 497 MSKEEILKVQTCVLKVNIHCDGCKHKVKKILQKIEGVYKTTIDSELGKVTVCGIIDPDTL 676 MSKEE +K+QTCVLKVNIHCDGCK KVKKILQKIEGV+ T ID+ELGKVTV G +DP L Sbjct: 1 MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDAELGKVTVSGNVDPSVL 60 Query: 677 IKKLAKSGKRAELWGAPK 730 IKKL KSGK AE+WGAPK Sbjct: 61 IKKLLKSGKHAEIWGAPK 78